SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020297739.1.29359 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020297739.1.29359
Domain Number 1 Region: 580-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.66e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 141-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000019
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 621-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000257
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 323-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000592
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 497-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000595
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 6 Region: 551-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000137
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 405-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000835
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020297739.1.29359
Sequence length 1155
Comment uncharacterized protein LOC109862187 isoform X2 [Pseudomyrmex gracilis]; AA=GCF_002006095.1; RF=representative genome; TAX=219809; STAX=219809; NAME=Pseudomyrmex gracilis; AL=Scaffold; RT=Major
Sequence
MDVAGDLNLQWVGDVDLHEEVICGLEAQLVTSGEEVIGACEEVAVEETVETVPDVAPTTE
SEILMIPQTNDMESIYIVPQDQGHDYLNIQVTEEVIADNWDRPPDDGVEIPEAKITQDNP
LEYDDIEIPLPPDQDSYQNIRPYPCDFCNRRFRKKVNLSNHILTHQTDRPHSCNLCGARF
VRKCDLNNHLKIHAYAPSSRDGLEDDLNDEDSLVAEEEDTTTGATRGRRKKVQSSAPRKR
KSNTTGMPKRNNTEDIKLEMGKYVYKSHDDEYTYSEDAQLFEDDLIDDNSARSDNYASSS
KWPKMSVTGEEHPTQWPVTDPTKPYVCQFCGVGFAREKALASHSRIHGGDSPFECTTCGE
MFWDVNSLREHVRVKHGGISQSPSDTEEFDNDGTYTGDNERIGEFYCNTCGVPFHRLDLL
KRHQKIHIKQEIETMEGSSQHHVCNVCGELFEEALALLAHAELHASSRRCLLCGTRCRDE
AEVAEHVKQNHAEDAPPNTCTMCGKTCKDKRSLLKHSWVHNVEKTFSCTKCGKRFHSKAR
LRRHMMSHRNKMVACDECGEEFPDGRALVSHRHSHNKELGGRSFPCRECGKTFGSRSSQQ
IHIRIHTGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVR
AHHSGPDPKCVGSATPYLCKVCSESFATPEEIVLHIVQHCDHNTALRRQPQTGPRKYKRR
RKLKPHETNTMVRRNEFTYDMTEADNGAIATANASNTGAGVSGGGGGGGSGVGGSSGVGG
GGGGSDSEDNTKRKLGKKNKQRSNVEEGYQNVLKSFESSLQNINSIVSNSKLNASKSKVS
KKKLRKEDKKQEAQTSNQSGRPKMIHTQKTRVPVELGSDGAKKGQKTKTMVTRTPKVMPN
EHKSGAFPGGERNRPRTKNVSYHIEGKMLLTPATFPAKSVKEEALLTQSSQQMIINIKQE
PGIQKTAHDSYKNNNGNIVGKNQESTPNVSKRKSSVAKKPKRQKQVTVKQEVNMSVEANT
EQQQLQLHNNNNNIMGNSGDSTQLMEPVMDGNHLEVAFEASVVTAQEEEDNADEGDEGRI
LRSDTTTEISNGDVKLSVKVESAPPTRMLAVHSVIASVDDVPETIIPDAVEYTCEMCAAV
FSSRAELLVHVPIHI
Download sequence
Identical sequences XP_020297739.1.29359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]