SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020304784.1.37734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020304784.1.37734
Domain Number 1 Region: 135-221
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-43
Family SH2 domain 0.0000107
Further Details:      
 
Domain Number 2 Region: 227-306
Classification Level Classification E-value
Superfamily RING/U-box 3.73e-38
Family RING finger domain, C3HC4 0.0000407
Further Details:      
 
Domain Number 3 Region: 50-134
Classification Level Classification E-value
Superfamily EF-hand 3.54e-32
Family EF-hand modules in multidomain proteins 0.0000572
Further Details:      
 
Domain Number 4 Region: 2-47
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.57e-17
Family N-terminal domain of cbl (N-cbl) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020304784.1.37734
Sequence length 443
Comment signal transduction protein CBL-B, variant [Loa loa]; AA=GCF_000183805.2; RF=representative genome; TAX=7209; STAX=7209; NAME=Loa loa; AL=Scaffold; RT=Major
Sequence
MKLFKEDRERIYDERSGARRNLTKLSLIFSHMLAELKAEFPDGHFIGENFRITKKEADAF
WRESFGIKTTVPWFEFRIALSKVHRLNTGLETLALKTTIDLTVNEHISNFEFDVFTRLFQ
PWNTLLHNWQLLAVTHPGYVAFLTYDEVKQKLQKYSNKPGSYVFRLSCTRLGQWAVGYVA
PDGKIYQTIPQNKSLIQALVDGSREGFYRFPDGRPTNPDLSHALQPSPEGRVKVTPEQYQ
IYCEMGTTFEMCKICAENNKNVKLEPCGHLLCTPCLQSWQESDGGGTCPFCRCEIKGTER
IIIDSFDPIEANKKLGYETIIEKSTVKNVRQSWPPRSEAVPPLRAPPLPPRYDSSSAGNS
PSVTHKQLTFDVPIINDNNFSTHGAEKLEQIANDALLNSVSQLKVLAPTTAEGSSYVNVV
TSGGKSNYEGLQYVNTAVINGQT
Download sequence
Identical sequences A0A1S0UEJ4
LOAG_05836T1 XP_020304784.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]