SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020314463.1.87700 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020314463.1.87700
Domain Number 1 Region: 35-517
Classification Level Classification E-value
Superfamily Sema domain 3.4e-100
Family Sema domain 0.00074
Further Details:      
 
Domain Number 2 Region: 1385-1508,1674-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.39e-34
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 858-948
Classification Level Classification E-value
Superfamily E set domains 0.0000000000014
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 4 Region: 949-1021
Classification Level Classification E-value
Superfamily E set domains 0.000000000104
Family Other IPT/TIG domains 0.035
Further Details:      
 
Domain Number 5 Region: 520-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000146
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1041-1120
Classification Level Classification E-value
Superfamily E set domains 0.00000000378
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020314463.1.87700
Sequence length 1898
Comment LOW QUALITY PROTEIN: plexin-D1-like [Oncorhynchus kisutch]; AA=GCF_002021735.1; RF=representative genome; TAX=8019; STAX=8019; NAME=Oncorhynchus kisutch; AL=Chromosome; RT=Major
Sequence
MPPSEKIAVLILGVLVLESPWNAHHSLASALQIQQAFASQNQTNNFVVDEVSRKVYLATV
NMVYQLNGTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNFNKLLELDREQGVL
VVCGSVYQGFCELRKMENISEIAVEFPPHGEKTVFPSMLNIAANHPNASTVGLIFRSHGG
NTRLLVGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNINDLSRLFTYDINPSEDNV
FKIKQEVKQKNKLNFVHAFIQKTYAYIAINNDANMGHKQNQPNSILARICLDTENTRKST
SESRKLTESFIQMPLQCGYNGNIYNRLVSVHPAAIHSGSGEGLESHLFGVFTKSDRKSAL
CAFRFSDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGAACVHKGNLVLQPEQLDCGAAH
LQHPLALRRPLRATPLFESLGLSSVAVDNIHNHTVVFLGTSTGRLRKLTLLKNLTVANQW
ALKLPAGESVHHIMTFDPMDRNYLYLMTSHHLLRVKVAACGQYRSCSDCLGAGDAHCGWC
TLESRCSIQRECSGWLMVRSWIGMGEGPQQCPSMTLTPQEISLSADIKDVGILINGSVPD
LVGSRVECDYGLGVATVATVHLDYGPAQIQTCPLLPRERYPHIPSGRDHLMVPVAIKVNG
TSVVSGTFLIYDCERTGAIHPKIACISCLSTRWRCYWDQNSHSCLSTKDDSKPSLLENSA
SCPSLVAKDVPPSPSGITQDFTLSLSNVEQQEELECDFGSEQRYEARWLSSVSEVKCSGV
MLTTVERSQVFQLSLRRKGHLDKYIDSPKPMNVEVYNCGVGSGDCSQCWGREDQGHLCGW
CDNICRTRDDCQYMSSQCPDPEITKISPLSGPLEGGTLLTVQGRNMGRRADVVKVSIGMV
PCKILPYRYTVSVQLVCVTGQTFDPTNDVVRVTVNQNAMGVSKEVYSYLVPKLLSMEPRK
GSRSGGTRVTLRGEYLDTGSQVRVKVNGTQDCTILTLTKDTIECTIPAALHTHTEAVSVC
VEFEDIPCQSAELLTQYIYEKNPTISYIKPRKSYLSGGRTITVTGQGFDLVQSVSMEVLG
IGQDACKVQSTSMITCSSLASSQSQQATVEFLLNGVLYTGDGPAFDGPDQEEEEEPHRGH
FLLEYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPSDLDLAPEEYSVMIGSYPCDISFH
NNQLFHCTINGSLGSSEGELPVTVRVGNFERIIAKVQLGGSELAIVVSIVVCCVLLLLCT
VALVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAELQTDMTDLTKELNRSQGIP
FLEYKQFVTRTFFPKMCSDYERSLVQPVYENDALGPRALPETHPLLQDWQPSNTAKPNME
EGITLFSTLLNNKHFLVTFVHALEQQKDFAIRDRCSLASLLTIALHGKLEYYTSIMKDLL
VDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINK
GSIDAITGKARYTLNEEWLLRENVEAKPQNINVSFQGCGMDSLAVKVVNTDTICQVKEKI
LEAFYKNLPFSQWPRAEDVDLEWFASGSNSRILQDLDNTSVMEXGRKKLNTVTHYQARSA
PSYTARHERQESNTLGRAKDLDTEKYVHLVLPHDEPFENKKSHRQSHRKKVLPEIYLTRL
LSTKGTLQKFLDDLFQAILSIPAERPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNCL
PLRFWVNILKNPQFVFDIEKTDHMDACLSVIAQAFIDACSVSDLQLGKDSPTNKLLYAKE
IPEYKKRVQCYYKQIHEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKKYRNQ
VVSALESNPTAKRTQLHHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_020314463.1.87700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]