SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020321242.1.87700 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020321242.1.87700
Domain Number 1 Region: 1404-1629
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.14e-81
Family Fibrinogen C-terminal domain-like 0.00000263
Further Details:      
 
Domain Number 2 Region: 840-1008
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-22
Family Fibronectin type III 0.00052
Further Details:      
 
Domain Number 3 Region: 1234-1393
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-20
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 1144-1231
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-20
Family Fibronectin type III 0.0000743
Further Details:      
 
Domain Number 5 Region: 571-657
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000342
Family Fibronectin type III 0.00085
Further Details:      
 
Domain Number 6 Region: 747-837
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000053
Family Fibronectin type III 0.0000408
Further Details:      
 
Domain Number 7 Region: 1056-1142
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000114
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 657-747
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000762
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020321242.1.87700
Sequence length 1635
Comment tenascin-like [Oncorhynchus kisutch]; AA=GCF_002021735.1; RF=representative genome; TAX=8019; STAX=8019; NAME=Oncorhynchus kisutch; AL=Chromosome; RT=Major
Sequence
MVMKGLLLGCVTVTVLLQLSSAGLVKKIIRHRRETLRDPSENMTLPHPDQPVVFNHIYNI
NVPSSSLCSVDVESPGGTEIKPKGSPVQSDMQTTEHLEHTADGENQIVFTHRINIPKQAC
GCDNPMHDMKDILSRLEMLESELSSLREQCGSGTSCCGAQITGEVATKPYCNGRGNFSTE
TCSCVCEPGWKGPNCTESECPNFCQDQGRCIDGKCVCFEGFYGDDCSMELCQVDCGDNGE
CIDAMCICEEGFTGNDCSQTNCLNNCLGRGRCVDDECVCDEPWTGYDCSELICPNDCYDR
GRCVNGTCFCEEGFTGVDCGEPICPSNCNNRGVCVNGQCVCHSGYSGEDCSKLTCPNDCT
ERGHCFNGRCICDPGFEGVDCSILSCPDNCSNRGQCVNGECVCNAGFEGEDCSEISCPMK
CLNQGSCVNGECVCSKGFAGDDCSIKTCPKDCLGHGECVDGKCVCFVGFTGKECSELTCP
NNCLNRGLCVNGQCVCNQGFAGEDCNEKTCPNNCLERGYCVDGKCVCFEGFQGLDCSLLT
CPGDCEDQGRCMNGVCLCNEGFIGEDCSEVSPPKDLTVLEVTPETVDLSWVNEMQVSEYL
VTYVPTGLGGLELDMRVPGDKKTATISELEPGVEYLISVFAVLNNKRSVPVSARVATHLP
APEGLKFTSVRETAVEVQWDPLDIPFDGWNLIFRNTKEENGEILNSLGSPDTMFEQSGLG
PGQEYEVNCEVVKNNTSGPPARKNVFTKIDSPREVDVRDVTDTTALVTWFLPVAVVDGVS
VTYGPNDNPSDRNTVELSSSDTQYHLGSLNPDTEYEVSLMAKRGEMTSVPVSENFLTDLD
APQDLQAVELTDESITLEWKNSLAKVDNYRIKYGPLSGGDHGELLFPTGPMDTTQAKING
LRPGTEYGMGVTAVKSERESLPSTTNAVTALDAPKNLEVESSTETELVLVWQKPVAKIDK
YKLLYVSADGYRAELTPFSNDIKYTLRNLTPGMLYTITLTAERGHKQSGTATISAATEAE
PIVEYLLVSDITPDSCKLPGQRKRTSLIVREAEPIVEYLLVSDITPDSCKLAWSAEEDLF
DSFVIMINDTSDDLASPQEVVVPGEERTTVLTELIEDTEYNIELYGVISGQLSNSISVVA
KTGLGTPTGIRFSEVTDTSATVHWAIPRARVDSYRVTYVAAQGGAPKTVTVGGTETQTVL
PNLTPGVTYQVSVISVKGQKESEPGSSSVTTALDKPRGLTAVNITDTQALLHWQPAIATV
DGYVITYSADTVSPVMERVSGNIVEFEMSSLTPATHYTVKVYAMRASAKSAVTTTEFTTD
VDAPQGLAASNIQTENAMLTWKAPRADITGYILSFESADGTIREVVLSPTATSYNMAQLS
ASTEYSVRLQAIAGPKRSRVITTVFTTIGVLYKHPRDCSQALLNGDTASGVHTIYLGGDE
GQPIQVYCDMDMDGGGWIVFVRRQSGKLEFFRNWRNYTAGFGDMNDEFWLGLSNLHKITV
AGQYELRVDLRDKGDVAYAQYDKFSVSDPRSRYKVHVGGYSGTAGDSMTYHHGRPFSTYD
HDNDIAVTNCALSYKGAFWYKNCHRVNLMGRYGDDSHSKGVNWFHWKGHEHSIEFAEMKI
RPSNFRNFEGRRKRS
Download sequence
Identical sequences XP_020321242.1.87700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]