SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020326586.1.87700 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020326586.1.87700
Domain Number 1 Region: 670-805
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.85e-50
Family I/LWEQ domain 0.00000261
Further Details:      
 
Domain Number 2 Region: 575-699
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.8e-46
Family I/LWEQ domain 0.00000775
Further Details:      
 
Domain Number 3 Region: 1566-1700
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.57e-45
Family VBS domain 0.00000937
Further Details:      
 
Domain Number 4 Region: 949-1085
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.24e-41
Family VBS domain 0.025
Further Details:      
 
Domain Number 5 Region: 478-569
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.01e-37
Family A middle domain of Talin 1 0.0000246
Further Details:      
 
Domain Number 6 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-31
Family Second domain of FERM 0.00000125
Further Details:      
 
Domain Number 7 Region: 312-405
Classification Level Classification E-value
Superfamily PH domain-like 4e-18
Family Third domain of FERM 0.0000424
Further Details:      
 
Domain Number 8 Region: 1191-1278
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000628
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 9 Region: 80-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000161
Family Ubiquitin-related 0.056
Further Details:      
 
Domain Number 10 Region: 802-931
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000204
Family VBS domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020326586.1.87700
Sequence length 1825
Comment LOW QUALITY PROTEIN: talin-2-like [Oncorhynchus kisutch]; AA=GCF_002021735.1; RF=representative genome; TAX=8019; STAX=8019; NAME=Oncorhynchus kisutch; AL=Chromosome; RT=Major
Sequence
MVALSLKICVCQRNLVKTMQFEPSTAVYDACRIIRERVPEAQTGQASDYGLFLSDEDLRK
GIWLESGRTLDYYMLRNGDIIEYKKKQRPLKIKMLDGAVKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEVMEEKKEMXRATLKKDRTLLRDERRXEKLKAKLHTDDDLNWLDHSR
TFREQGVEETETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEF
AGIQAQIQFGPHIEHKHKPGFLDLKEFLPKEYIKQRGNEKKIFQDHKNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKVRVKKXRGKNKLVPRLLGIPKSXSDEVEEKTKDVVQEWPLT
TVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGD
EESTMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGVDLQLKAELQNIQVNKKNETSES
DPTDTDYTAVGCAITTISSNLTEMSKGVKLLAALIEDDTGGSNDLMGAARNLAGAVSDLL
KAVEPASGEPRQTVLSAAGSIGQASGDLLLQIGENESDERFQEVLMILAKVVANAAAMMV
LKAKNVAQVADDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISXPVCQEQLIEAGKLV
DRSVEGCVQACLSATVDGEMLKQVSSAASVVGQALXDLLEHVCHYASHGEPVGRYDQATD
TIMTVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDAEVEVDVDNSKKLLAAAKLL
ADATARMVEAAKGAAAYPENEDQQQRLREAAEGLRVATNAAAQNAIKKKLINRLENAAKQ
AAAAATQTIAASQNAAASNKNTAAHQQLVQSCKAMADHIPRLVQGVRGSQAQPEDLTTQL
ALITTSQNFLQVAKAVSHSLNNCVNCLPGQKDVDMALRSIGEASKKLLGETLPPSTRSFQ
EAQSELNQTAADLNQSAGDVVHASRGSSTQLADASGKFREDFDDFLDAGIEMAGHTQRKD
EQIQVIGNLKNISMASSKLLLAAKSLSVDPGAANAKNLLAAAARAVTESINQLITLATQQ
APGQKECDNALRELEAVKGMLANPNEPVSNLSYFHCIESVMENSKVLGESMAGISQNCKT
GDVPAFGGCVGLASKALCGLTEAAGQASYLVGVSDPNSQAGHQGLVDAIQFARANQAIQM
ACQNLVDPDSSPSQVLSSATIVAKHTSALCNACRLASSKTANPTAKRHFVQSAKEVANST
ANLVKTIKALDGDFSQENRNTCLVATAPLIEAVENLTAFASNPEFASSPAQISNEGSAAQ
EPILQSARSMLDSSTHLLKTARSLVINPKXPPTWSVLAGHSRTVSDSIKGLITAIRLAHS
PGQRECDYSIDNINRCIRNIEQASLAAVSQNLASRDDISLGXDPLQEQLTSTVQEIGYLI
NPISTAARGKLPTRHKGTSDQLAGYFEPLIRASWRGVQAAGPSAADDLPDQTKTLAESAL
QMXHAAKEGGGNPSQASHTMMPXRRLPSXMREAVDDIMVTLNEAASEEGMVGAMVDSIAE
AMNQLDEGTSPEPEGSFVDYQTTMVKYSKAIAVTAQEMMTKSATCPEELGGLASRVTTDY
SQLALQGRLAAHTAEPQEIGFQIKAGVQELGHGCIFLVQKAGALQITPSDSYTKRELIEC
ARTVTEKVSMVLSALQAGNKGTQACITAASAVSGIIAELDTTIMFASAGTLNAENDESFA
DHRENILKTAKALVEDTKMLVSGAASGQDKLAQAAQSSAKTXTQLTDVVKLGAASIGCDD
PETQVVLINAVKDVAKALAELNRSH
Download sequence
Identical sequences XP_020326586.1.87700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]