SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020332923.1.87700 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020332923.1.87700
Domain Number 1 Region: 34-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-28
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 2 Region: 146-242
Classification Level Classification E-value
Superfamily LCCL domain 3.14e-24
Family LCCL domain 0.00073
Further Details:      
 
Domain Number 3 Region: 253-314
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000231
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020332923.1.87700
Sequence length 314
Comment discoidin, CUB and LCCL domain-containing protein 1-like, partial [Oncorhynchus kisutch]; AA=GCF_002021735.1; RF=representative genome; TAX=8019; STAX=8019; NAME=Oncorhynchus kisutch; AL=Chromosome; RT=Major
Sequence
MSVKKKVNGFFVVWSILSAVGEKLDDGCGHSVLGPESGVLSSKSYPGTYPNNTWCEWKIQ
VPEGNSLVIRFGDLDVEARDCQSDYVKVLKGGYGGEHVYGTFCGSLKSYPREMHTDTNEV
IVQFRSGRHISGRGFLLSYSTGDNRDLLTCLDKGSHFSDLKYRKYCPAGCKAVAGDISGD
ISQGYRHTSVLCKAAVHAGVILDELGGWVSVETQKGLSHYPATRANGIQSKDGSLSDALF
TFVTNDCKDQSVLRTVSVNASSWWKRAGEMGHQSDWAPNSSQADPGSGSRSWAADQNDSL
QWLLLDLGEEKRIT
Download sequence
Identical sequences XP_020332923.1.87700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]