SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020340722.1.87700 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020340722.1.87700
Domain Number 1 Region: 627-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000581
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 2 Region: 732-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000642
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 206-228,294-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000916
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 4 Region: 588-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000991
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 5 Region: 534-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000157
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 669-722
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000059
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 128-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000339
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020340722.1.87700
Sequence length 874
Comment zinc finger protein 493-like [Oncorhynchus kisutch]; AA=GCF_002021735.1; RF=representative genome; TAX=8019; STAX=8019; NAME=Oncorhynchus kisutch; AL=Chromosome; RT=Major
Sequence
MESIDLEREDPPSSLSGYANGEIMTLEISDVSPDLLVLEVKDSNLPESIHGSLDMEMNAD
FHEDDDDGHGFANVELQFFPCDACEASFTSEPELEQHLISSHSICDVASERGRQKAKSME
TEGVSPLHTCMTCGKVFKYLTSFRKHEETHIKPLYTCKTCGKEFKYLTSFTKHQDTHVVP
RTRGRRKGKLIKAVGLSVNKKMKGLHTCKHCGKEFKYVTSFIKHEKTHRITRTKRSHKKQ
RKLSTSKIILRLQGNRKDATETHVRANRKNSEDANDQDACTLISSAEQQTPDTKRSPPFP
CLDCGKIFKFFKSYQKHQKRHAWAQGKSEGVPPKQKHGPEAKENIRCPVCGRAFNKQTTR
NKHQNIYHLKNNLHKKTNALTCCECDRHFEKADLFQKHKCFHLRKHVKAFIEAGRVSQDG
DVFYCQLCVLQLTSGLEFENHARDIHPDQYRKILKAVGNIIKDTLKGLQTRRVDNQSTSQ
EEPEINLNSVGETEEDGSRQFICKNCGEYFLYRVSFTFCGKCLKDRKDRRKASKVYHCEE
CGQHFGRKDHLKRHSYSHSGSSFVCSDCGVKFRDPGELRTHEKTHQVRNHACQQCGKRFE
QEEELMLHREVAHPEPGGYTCHRCGKTFSTVKNLGKHRMIHSNKTPHVCSNCGTKFKRRE
HLRRHESLHTNEKPHLCHCCGDTFGRKEDLNTHLGKMHIISRHFLCKACGTSFKDRNALR
RHRYHSHTKAGKVFQCEACGLSFGRADHLKRHKHTHSTERPFSCSMCYKVFHRADNLKKH
ERNHRNKWLEYLNTHRHKTPKQESRFSERSKWKLRRSEASALLKLIQSHSKQQQHICYVC
KKTFRGIYYLKRHRLLNCCVQRNKMDSFRYGTVK
Download sequence
Identical sequences XP_020340722.1.87700 XP_020340732.1.87700 XP_020340741.1.87700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]