SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020361502.1.87700 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020361502.1.87700
Domain Number 1 Region: 37-522
Classification Level Classification E-value
Superfamily Sema domain 1.57e-88
Family Sema domain 0.00076
Further Details:      
 
Domain Number 2 Region: 1390-1513,1679-1864
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-34
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 954-1026
Classification Level Classification E-value
Superfamily E set domains 0.00000000000306
Family Other IPT/TIG domains 0.039
Further Details:      
 
Domain Number 4 Region: 863-954
Classification Level Classification E-value
Superfamily E set domains 0.0000000000102
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 5 Region: 1046-1128
Classification Level Classification E-value
Superfamily E set domains 0.000000000255
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 6 Region: 525-577
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000164
Family Plexin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020361502.1.87700
Sequence length 1903
Comment LOW QUALITY PROTEIN: plexin-D1 [Oncorhynchus kisutch]; AA=GCF_002021735.1; RF=representative genome; TAX=8019; STAX=8019; NAME=Oncorhynchus kisutch; AL=Chromosome; RT=Major
Sequence
MPPSEKIVVLIFGVLVLESSWNAQHSPWLASALQIQQAFASPNQTNNFVVDEVSRKVYLA
TVNMVYQLNRTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNFNKLLELDREQG
VLVVCGSVYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFRSH
GGNTRLLVGATYTGVGTTFFPKNHSKEDLRFENTPEIAIRSLNINDLSRLFTYDINPSED
NVFKIKQEVKQKNKLNFVHAFIQKTYSYIAINNDANMGHKESQPNSILARICLDTENPRK
STSESRKLTESFIQMPLQCGYNGNIYNRLVSVHPAEIHSGTGEGLESYLFGVFTKSDRKS
ALCAFRFSDIEEEIRQGRRNCSNSPSSEVQVLDSVIQGSGAACVHKGNLVLQPELDCEAX
HLQHPLALQRPLRATPLFESLGLSSVAVDNDITHCGFLGTSTGRSHSACLPQLTLLKNLT
VANQWSLKLPAGESVHHIMTFDPIDRNYLYLMTSHHLLRVKVAACSQYRTCSDCLGAGDA
HCGWCTLESRCSIQRECAWGPLARSWIGLGEGPQQCPSMTLTPPEISLSTDIKDVGILIN
GSVPDLVGSRVECDYGLGVATAATVHLDYGPAQIQTCPLLPRERYPNIPPGRDHLTVPVA
IKVNGTSVVSGSFVIYDCERTGAIHTKTACISCLSTRWRCYWDQDSHSCLSSKDDSKHSL
LENATFCPSLVAENVAPSPSGMTQNFTLFLDNVVQGEELQCDFGNEQRYDSRWLEDNSGV
KCSGVTLTTVEKSQVFQLSLRRKGHLDKYIDSPKPMTVEVYNCGVGNGDCSQCWGRENLG
HLCGWCDNSCRPRNDCQYMNSQCPDPEITKISPQSGPLEGGTLLTVQGRNMGRRAEVVEV
SIGMFPCTIIPDQYTVSVELVCVTGQAIDPTKNFVRITVNQKAMAVSKEAFSYLVPKLLS
MEPRKGSRSGGTRVTIKGEHLDTGSQIRVKVNGTQECTILTLTEDTIECTMPAALHTHTE
AVSVCVEFEYIPCQRSELLTQYIYEKNPSISYIKPRQSYLSGGRTITVTGQGFDLVQSVT
MEVLDIGQAACKVQPPSMITCSSPTSSQSQQATVEFFLNGVLYTGDSPVFYGPGQEEEED
PHGGHFLLEYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPSNLELAPEEYSVMIGSYPC
DISFHNDQLFHCSINGSLGSSEGELPVTVQVGNFQRIIAKVQLGGSELAIVVSIVVCCVL
LLLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNS
SQGIPFLEYKQFVTRTFFPKMCSDYERSLVQPVYENNALGPRALPETHPLLQDWQPSNTA
KPNMEEGITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSI
MKDLLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIK
QQINKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLAVRVMNTDTICQ
VKDKILDAFYKNLPFSQWPQAEDVDLEWFASGSNSRILQDLDNTSVMEDGRKKLNTVTHY
QIPEGASFAMSMKDKRDNTLGRAKDLDTEKYVHLVLPHDELFENKKSHRQSHRKKVLPEI
YLTRLLSTKGTLQKFLDDLFQAILSIPAERPPLAIKYFFDFLEEQADKRGITDPDTLHIW
KTNSLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKL
LYAKEIPEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAK
KYRNQVVSALESNPTAKRTQLHHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_020361502.1.87700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]