SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020451640.1.23826 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020451640.1.23826
Domain Number 1 Region: 461-596
Classification Level Classification E-value
Superfamily TIMP-like 2.43e-25
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 236-332
Classification Level Classification E-value
Superfamily Immunoglobulin 5.78e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 415-468
Classification Level Classification E-value
Superfamily BPTI-like 1.01e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 4 Region: 350-409
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000014
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.018
Further Details:      
 
Domain Number 5 Region: 152-204
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000624
Family Ovomucoid domain III-like 0.031
Further Details:      
 
Domain Number 6 Region: 62-108
Classification Level Classification E-value
Superfamily Elafin-like 0.0000017
Family Elafin-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020451640.1.23826
Sequence length 598
Comment WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Monopterus albus]; AA=GCF_001952655.1; RF=representative genome; TAX=43700; STAX=43700; NAME=Monopterus albus; AL=Scaffold; RT=Major
Sequence
MKATMCKIPTHLFEDSCIKDTRWHNVPNSSKRGSGWIHAYFLLLLVCKFSVLSLCASVAG
SKFEHEGFCPNKLSSNLWVDAQSTCERECNVDEDCADFEKCCTNVCGLNSCVAARFSDGT
PAQPEGQGGGQGDDAPISTATCDGFMCSQQGATCDIWDGQPICKCQDRCEKEPNFTCASD
GLTYFNRCYMDAEACIRGVTLTVVTCRFYLAGPHTSPVPQDTTAHPTPTSSQEDPMPPTL
YSNPHHQSIYVGGTVSFHCDVIGVPRPDVTWEKQSGRRERLVMRPDQMYGNVVITNIGQL
VIYNAQVWDTGIYTCIARNSVGVLRADYPLSVIRRADDDFSEDPEMPMGRPFSPADCLAE
VDLRVCSGERHVDWYYDNKVGSCLAFSNGGCDESRNQFETYEECKASCQREGMGICSLPA
VQGPCKTWEARWAWNSLMKKCQAFAYGGCHGNANSFRTKKECEANCPQPKRKTCKTCRVK
GKMVPSLCQSDFAIVGRLTELVEDLDSGLARFSLEEVLKDEKMGLTLFNTRHLEVTIAKI
DWSCPCPNITMEENPLLVMGAVQDGMAIIQSDSYVRAITERRLKKLREVLEKKACKAS
Download sequence
Identical sequences XP_020451640.1.23826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]