SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020457650.1.23826 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020457650.1.23826
Domain Number 1 Region: 386-749
Classification Level Classification E-value
Superfamily L domain-like 1.46e-50
Family Ngr ectodomain-like 0.09
Further Details:      
 
Domain Number 2 Region: 60-237,316-433
Classification Level Classification E-value
Superfamily L domain-like 1.78e-43
Family Ngr ectodomain-like 0.0054
Further Details:      
 
Domain Number 3 Region: 761-865
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.8e-26
Family Toll/Interleukin receptor TIR domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020457650.1.23826
Sequence length 890
Comment toll-like receptor 13 [Monopterus albus]; AA=GCF_001952655.1; RF=representative genome; TAX=43700; STAX=43700; NAME=Monopterus albus; AL=Scaffold; RT=Major
Sequence
MEFSSDFYNRNLKLDPGAKEDKTMQVGKRKLIIFLYLLHFSTFAAPVTGFSLKACRMTSN
TVICAKSQLKAVPRDIPSTTKVADLSANKISRIQVADFKNLLLLTQLELNRNYISQIDNG
AFANLICLEKLNLNNNKLVELGEDVFHGLSNLTELRIGGNRIQTVAFSSFRSMTSLKFLD
ISHNKLHEIAKVHSILQHLPHLRELYIKNNNINTFHSWELTNSSLELGYLDLSQNPIAVF
QITADIFPHLIWFNIGGSRTKQQMMWDVRNKTFLNQVSTLDISGLQMALGDMKTLLETAN
SSLRTLRMNAMKHSLTALINISCTIPTMSNLQLRYYKLRSVSSTMFTLCIYVTELDLTQN
HIQIIHVNAFRSLPGLRILNLSQNKLSSVPVAIRNLPTLRELNLSANNISRLGCDDFANQ
TMLRQLSLYNNMISALNECVFKDLIRLQVLKLQTNHINKLNGAFQRHLPNLRQLYLNVNQ
LTNIKYGEFKGLHSLQNLSLHDNQIETLEKGCFIGLTNLTDMLLQKNLITQKALNNGSFN
DLISLRRLDFRDNYIKFENDSLLPNPPFSQLSCLETLAIPSQHGKGTSKLPRNLLQGLTN
LIEFSVRDIQLIFLHKDMFIYTPQLQTLDISSNDLMDLSSDLFSPVQNLKSLYISRTSLQ
SLDFLIGANLTKLEFLQARKNQYSVISEEIIKSVPALVYMDLQGNSFTCDCNNAWFLKWA
EDNNQTQVFDAFNFVCNFPLDLKGMKLLDLDIRHIFLFSTSGKPIIDNITDAIYGSRKTI
CVISRRYLESEWCSREIQVASFRLLDEQKDVLILVFLEEIPTALLSPYYRMKKLLKRKTC
LSWPRAIQHTNLFWEKLRQALKTTEDVGGDRFPITLQNRVYQNRNTVLLV
Download sequence
Identical sequences XP_020457650.1.23826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]