SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020459544.1.23826 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020459544.1.23826
Domain Number 1 Region: 677-833
Classification Level Classification E-value
Superfamily Spectrin repeat 5.33e-19
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 2 Region: 351-502
Classification Level Classification E-value
Superfamily Spectrin repeat 8.34e-17
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 3 Region: 497-623
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000916
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 1109-1249
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000733
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 5 Region: 1040-1138
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000353
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 6 Region: 177-293
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000185
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020459544.1.23826
Sequence length 1349
Comment nesprin-2-like isoform X1 [Monopterus albus]; AA=GCF_001952655.1; RF=representative genome; TAX=43700; STAX=43700; NAME=Monopterus albus; AL=Scaffold; RT=Major
Sequence
MQSMRPKLEDGLTDTDSVEQVLLELSALFPSLVDIREMSGSMNLKNQETERLHMLSREWT
ESMIRISDMNGELRAEHQLSQNFQEKSTNLMSIQEKLEQELVSRKPQSHSNLQEMLTVHQ
RLQAEIVTGHQLLQGLICDAVMATENETKEKRSEVMAQVASLKTGWINSVAVVGQCRSLV
KEQLHQWRTYRHGLKVLWKLLKNVDILVPPPGPAPCALQQLQSCADLCQCVEEALGLHST
VYAQTLAAGRYLCETVAEGECRSRLQAERQVIDEAWERATSLLRSRSDLVNTTVQKWSEC
QDEIINIMSGLDELQTRLKQQLPERSEGSEDETFIQESERSLQHLASGMKELATMKTDLS
QYVTAGDSALLEQQLEQLHSQWEELCMKVSLRRQEIADSLNAWTIFNDKNREFCNWLTQM
ENKVCHSGDLSIKDMVEKLKKDCMEEINLFSENKSHLKQLGEQLLLASDEAKHTQVHSSL
QEVSQRWHNLFHQIEARVKKLKETLVTVQQLDKNMSNLRLWLYRIEAELSRPITYNVCHL
QEIQRRLAEQQELQKDIEQHTEGVASVLSLCDVLLRDEDAAGDAEAEGDSLQETSRSLDQ
RWRTICAMALDRRLRIEETWRLWCKFLDDYSQFEDWLKMAEHTAANPNSADVLYTVAKEE
LKTFEGFQRQVHEHLTQLELLNNQYRRLARENRTDRASQLKAMVHEGNRRWDTLRRRVAA
ILRRLKHFTSQREEFERTRESMLAWLTELDLQLTNVEHFSESDIHHKIQQLNSLQKEITL
NTECIDGLIVFGESLIQKSSPQDAALIEDELEELHSYCQEVFSRLVRFHQRLSQPPIITV
EPELSGITFCLESSLELIGRPWLGRSQGSLPATPTHLLESPLERSGRETPVSVDSLPLEW
DHTGDVGGSSSHEDEDEEEEGTYFSALSAPGRSKVVHESPRWPPPADTEPQPLQQDAQGH
TEAPPALASTPLQQGYLRLMSQCSGSIENIRRVSLILDDKEQPEELGLTGLMASDKQSGV
IERWELLQAQPSSDQQADPREPQWLASDLDNITSWLETVILELGCPQQSDPAASVEDMEA
RAKELKELQKTFTHYKSVMLSVNLRAQKSPDLQERLVRMNRDWSRACTGLQQRDTSLRKT
LMRCQDFHETLHSLLLWLAHAESRRYTVDISCPDTPVRALQQHHKTLTDLQAELRDRRAQ
QASLQALWSQLQPQDKAEENDEAREKLHVTGSKLKLLLREVEQDLSSLQQRLGCESVSDV
QGQSASAEVTHSKKGSSTQREMREPSSPPRSFFSRVLRAAFPLHLLLLLLLLLPCLILLS
ASDSSCTVTNNFARSFYPMLHYTNGPPPT
Download sequence
Identical sequences XP_020459544.1.23826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]