SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020466316.1.23826 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020466316.1.23826
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 3.53e-97
Family Sema domain 0.00095
Further Details:      
 
Domain Number 2 Region: 1386-1509,1675-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.06e-34
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 858-949
Classification Level Classification E-value
Superfamily E set domains 0.000000000000117
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 4 Region: 1041-1120
Classification Level Classification E-value
Superfamily E set domains 0.00000000000191
Family E-set domains of sugar-utilizing enzymes 0.032
Further Details:      
 
Domain Number 5 Region: 516-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000654
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 953-1030
Classification Level Classification E-value
Superfamily E set domains 0.000000000407
Family Other IPT/TIG domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020466316.1.23826
Sequence length 1899
Comment plexin-D1 [Monopterus albus]; AA=GCF_001952655.1; RF=representative genome; TAX=43700; STAX=43700; NAME=Monopterus albus; AL=Scaffold; RT=Major
Sequence
MPPSIGIAVLLLGVLALETRLSASALHIQQAFPSTNQTNNFVVDPVSRKVYLATVNTVYQ
LNGTLSIEVAKRTGPVEDNLLCHAPQLPQAPCEHSKSLTDNYNKLLKLDREQGVVLVCGS
VYQGFCELRKMENISEIAVEFPPQGEKTVFPSMLNIAANHANASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPNNRSKEDLRFENTPEIAIRSLNIKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESQPNSILARICLDTENPRKSTGPESR
KLTESYIQMPLQCGFNGNIYNRLLSVYQTEIHTEDVKGSEPYLFGVFSKADRKSALCAFK
FGDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGAACIQKGNLVLQPEQLECGAAHLQHP
LALRRPLRAIPVFEYPGLSAVSVDNVHNHTVVFLGSNNGRLRKLTLLANMTLANQWKLKL
PGSETVHHIMTFDPNDRNFLYLMTSHHMLRVKVADCDQRKSCNDCLGAGDPHCGWCTLEN
RCSIQKECAQGLLARSWISIGEGAQQCPSMTLTPPEISISADIKDVGILINGSVPDLVGS
RVECEYGPGVSTAATVHLDYGPAQIQTCPLLPLEKYQAIPPGTDHLTVSVAIKVNGTSVV
SGSFIIYDCERIGAIHPKTSCVSCLSTRWKCYWDQENHLCVSSKDESKHNLLENAASCPR
LVASEVPPSPSGTAQDFTLSLSNIQEGQKLDCDFGTEQRYEARWLNSSAVKCSGVTLTTN
QRSQVYHLNLRRRGGPSGWGADIFVDSPQPMKVEVYNCGVGSSDCSQCWGREDQGHLCAW
CENSCRPRDDCQPIRDQCPAPEIHKISPLRGPVEGGTLLTVQGRDLGRRAAAVKVLIGDA
PCVVLPEHYTVSVELVCVTGRSTYARTDIVQVDVDHSGTGTSKESFSYLVPKLQSMKPRN
GSRAGGTRVNISGEHLDIGSQVRVRINNTLECIITEKADETIECIMPPALQAHSDLVTVC
VEFENLPCQSGELSTSYTYEKNPIISSIHPTKSYLSGGRTITVKGQGFDLVQSVTMQVLK
IGQTHCTVFSPSSIICSSPASSQSQQTSVQFFLNGVLYTGDSPSSSDSEPEEEESELHKG
HFLLEYVEDPQFFTANKEKLIKHHLGEPLTLIINKGPSDLELVPEEYSVMIGPYPCNISF
HNDQLFHCTMNELLSSSERELPVTVQVGNFHHTIAKVQLGGSELAIVVSIVVCCVLLLLC
TVALVVYCTKSRRAERYWQKTLVQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGI
PFLEYKQFVTRTFFPKMCSDYEKSLVQPAYENDALGPRALPETHPLLQDWQATHTTRPNI
EEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDL
LVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQIN
KGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKEK
IIEAFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQIPE
GASLAMSMKDKKENTLGRVKDLDTEKYVHLVLPHDELMETKKSHRQSHRKKVLPEIYLTR
LLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNS
LPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAK
EIPEYKKRVQRYYQQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRN
QVVNALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_020466316.1.23826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]