SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020485130.1.8198 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020485130.1.8198
Domain Number 1 Region: 29-516
Classification Level Classification E-value
Superfamily Sema domain 1.57e-98
Family Sema domain 0.001
Further Details:      
 
Domain Number 2 Region: 1387-1512,1678-1862
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.61e-34
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 861-952
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000076
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 4 Region: 952-1043
Classification Level Classification E-value
Superfamily E set domains 0.0000000000054
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 5 Region: 1044-1124
Classification Level Classification E-value
Superfamily E set domains 0.0000000000293
Family E-set domains of sugar-utilizing enzymes 0.049
Further Details:      
 
Domain Number 6 Region: 519-571
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000767
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020485130.1.8198
Sequence length 1902
Comment LOW QUALITY PROTEIN: plexin-D1 [Labrus bergylta]; AA=GCF_900080235.1; RF=representative genome; TAX=56723; STAX=56723; NAME=Labrus bergylta; AL=Scaffold; RT=Major
Sequence
MPPSVEIAVLLLGVLTLETRRSASALHIQQAFASPNQTNNFVVDPVSRKVYLATVNTVYQ
LNGTLSIEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGVVLVCGS
VYQGFCELRKIDNISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSXNIKDLSRLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESLPNSILARICLDNENPRKPTGPESR
KLTESYIQMPLQCGFNGNIYNRLLSVYPVDIQTDDGRGSEPYLFGVFSKADRKSALCAFK
FGDIEEEIRQGRRNCSSSPSSPSSDVQVLDSVIQGSGAICIHKGNLVLQPEQLDCGAAHL
QHPLALRRSLRAIPLVEYPGLTSVSVDYVQNHTVVFLGTSNGRLRKLTLFANMTLANQWT
LKLRGGEAVHHIMTFDPSDRNFLYLMTSHHMLRVKVAECDQWRDCGDCLGAGDAHCGWCT
LENRCTIQKECAQGLLARSWISMGEGPQQCPSMTLTPPEISISADIKDVGILINGSVPDL
VGSRVQCEYAPGISTDATVHLDYGPAQIQTCPLLPRENYQPILPGTDHLTVSVAIKVNGT
SVVSGSFIIYDCERTGAIHPKTSCLSCLSTRWKCYWDQENHLCVSNKDESKPNLLENAAS
CPSLVPSEVPPSPSGMAQDFTLSLSNIQEGEKLECDFGREQRYEAMWLNSSTVKCSGVTL
STYQRSQIYQLNLRRKGYFSGHGENIFVDSPQPMRVEVYNCRVGSSDCSQCWGREDQGHL
CGWCENICKPRDDCQPIRDQCPAPEIHKISPQRGPVEGGTLLTIQGKNLGRRAGAVKVSI
GDTACAIVPEFYTVSVELLCVTGPSSQERTDIVQVDVDQSGMGTSKETFSYLVPKLLSME
PRKGSRAGGTRVTIMGENLDIGSQIRVMINNTLQCLITEKTDETIDCTMPPALQPHTESV
AVCVEFENLPCQSVELSTTYTYEKNPTISFIHPKKSFLSGGRTITVTGQGFDLVQSVSMQ
VLGIGQTHCTVVSPSMITCPSHASSQSQETSVQFFLNGVPYTGDSPTSFDSEADEEEGEP
HKDHFILEYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPSDLELMPEEYSVMVGSYPCN
ISFHNDQLFHCTINGLLSASEREMPVTVQVGNFRHTIAKVQLGGSELAIVVSIVVCCVLL
LLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRS
QGIPFLEYKQFVTRTFFPKMFSDYEKSLVQPAYENDPLGPRALPETHPLLQDWKANNTTR
PNVEEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIM
KDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQ
QINKGSIDAITGKARYTLNEEWLLRENVEAKPQNMNVSFQGCGMDSLSVRVMNTDTIYQV
KEKILEAFYKNLPFSQWPRAQDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQ
IPEGASLAMSMKDKKENTLGRVKDLDTEKYVHLVLPHDELMENKRSHRQSHRKKVLPEIY
LTRLLSTKGTLQKFLDDLFQAILSIPPERPPLAVKYFFDFLEEQADKRGITDPDTLHIWK
TNSLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLL
YAKEIPEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRKYRNEFNTHLALTEIYKYAKR
YRSQVVSALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_020485130.1.8198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]