SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020498498.1.8198 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020498498.1.8198
Domain Number 1 Region: 457-592
Classification Level Classification E-value
Superfamily TIMP-like 4.87e-26
Family Netrin-like domain (NTR/C345C module) 0.02
Further Details:      
 
Domain Number 2 Region: 233-328
Classification Level Classification E-value
Superfamily Immunoglobulin 3.94e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 411-464
Classification Level Classification E-value
Superfamily BPTI-like 9.36e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0043
Further Details:      
 
Domain Number 4 Region: 346-405
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000922
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.022
Further Details:      
 
Domain Number 5 Region: 150-200
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000402
Family Ovomucoid domain III-like 0.026
Further Details:      
 
Domain Number 6 Region: 59-104
Classification Level Classification E-value
Superfamily Elafin-like 0.000000497
Family Elafin-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020498498.1.8198
Sequence length 594
Comment WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Labrus bergylta]; AA=GCF_900080235.1; RF=representative genome; TAX=56723; STAX=56723; NAME=Labrus bergylta; AL=Scaffold; RT=Major
Sequence
MYSYPLKLSEDGWENDKFVHNESKTNTLVLGWIRTYFLILCVCKLPELSLGASVAGSNVD
HEGFCPNKLNSNLWVDAQSTCERECNVDEDCAGFEKCCTNVCGLNSCVAARFSDGTAAQP
DGQGGGTGSDALNSTATCEGFICSQQGAICDIWDGQPICKCQDRCEKEPNFTCASDGLTY
FNRCYMDAEACIQGVTLTVVTCRFYLAGPNTSPLPQDTTANPTPTSSQEDPLPPSLYSNP
HHSSIYVGGTVSFHCDVIGVPRPDVTWEKQSERRERLVMRPDQMYGNVVITNIGQLVIYN
AQVWDTGIYTCIARNSVGVLRADYPLSVIRRADDDFSEDPEMPMGRPFSPADCLAEVDVR
VCSGERHVDWYYDSKLGSCMAFSNGGCEDSRNKFETFEECKASCQREGMGICLLPAVQGP
CKAWEPRWAWNSVMKQCQAFAYGGCHGNANSFATKRECEANCPQAKKKPCKTCRAKGKMV
PSLCRSDFAIVGRLTELVEDLDSGLARFSLEEVLRDEKMDLTFFNTKHLEVTIAKIDWSC
PCPNITMEENPLLVMGVVQDGMAIIQSDSYVRAISERRLKKLREVLGKKTCEAK
Download sequence
Identical sequences XP_020498498.1.8198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]