SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020508327.1.8198 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020508327.1.8198
Domain Number 1 Region: 53-525
Classification Level Classification E-value
Superfamily Sema domain 7.98e-127
Family Sema domain 0.0000562
Further Details:      
 
Domain Number 2 Region: 1373-1500,1696-1885
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-52
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 976-1058
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000165
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.043
Further Details:      
 
Domain Number 4 Region: 1058-1162
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000294
Family Other IPT/TIG domains 0.048
Further Details:      
 
Domain Number 5 Region: 873-970
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000165
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 6 Region: 528-579
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000593
Family Plexin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020508327.1.8198
Sequence length 1915
Comment LOW QUALITY PROTEIN: plexin-A4 [Labrus bergylta]; AA=GCF_900080235.1; RF=representative genome; TAX=56723; STAX=56723; NAME=Labrus bergylta; AL=Scaffold; RT=Major
Sequence
MTSLTRTRTCFFVCCFLSCLSLPVTSQTVVQAPQAHSAGSQVITALLQEDEYSSFHAENP
EWTFNHLAVDYRNGNVYLGAVNRIYKLSPGLEVQVSHETGPDDDNRKCYPPRIVQPCSEP
LTLTNNVNKMLLMDYRENRLLACGSLYQGICKLLRLDDLFKLGEPFHKKEHYLSGVNESG
SVFGVIVSYSNTSPDMLFVATAVDGKPEYFPTISSRKLARNSEEDGMFAYVFHDEFVASM
IKIPSDTFTVIPDFDIYYIYGFASGNFVYFLTLQPEMGDGPTTGSSSTGREQVYTSKIVR
LCKADTAFNSYVEVPIGCISGNVEYRLLEAAYLSKAGANLARSLDVAPDDDVLFAIFSKG
QKRRPRQASQDSALCVFSLRKINEKIKERLKSCYKGEGTLDLAWLKVKDIPCSSALLTID
DDFCGLDMNAPLGVSEMVHGKPLFSDGIDKMTSVIAYVYKNHSLVFVGTKSGRVKKIRVD
GSSRALQYETVQAVENGPILRDMAFSSDNHYLYVMSESQLSRVPVEVCGQYSTCSECLGS
GDPHCGWCVLHNMCTRKEKCERSSEPRRFASDIKQCVRLSVHPNNISVSQFSVTLVLEAH
NVPELSAGVNCTFEDLAEMNGLVEGNRIRCSSPAEKEMPRIIVDKGDHQIVQLYLKSKET
GLAFANTSFVFYNCSVHKSCLSCVSSPYQCHWCKYRHDCTHDPRTCSFQEGRVKKAEGCP
QLLPADRILVPVNVVKPITLRAKNLPQPQSGQRGYECLLTIQGNEHRVPALRFNSSSVQC
QNTSYFYDGMEMSSLPVELIVIWNGDFSIDNPAHNKVHLYKCDAQRGSCGLCLKADPLFG
CVWCEGENRCTLKQHCPHLENQWLEHNGINSKCTNPRITQITPLRGPREGGTLVTIRGEN
LGLEFREIQGNVKVAEVDCTPIREGYIPAEQIVCEMGKAEISQYTGNVRVCVGDGDCKPE
FMTKSNKYYYFVIPRIINLKPSRGPVSGGTIVNITGSHLDAGSNVSIMFKDQPCTYLRRG
GQWLTCRTHASLNGYGNVSVSVSIDRAHLQKDLRFEYVEDPTIVKIEPEWSIYSGHTPVT
VTGTNLDIIQTPLIRAKYNSFETLNLCQVLSATTMLCQAPELSISLARHQEVPERPDEFG
FKLDDVQALMALNNTNFIYYPNPEFEPLSVSGVLELKPGSPVILKGRNFLPPTNSGNGKL
NYSVXIGKKPCMLTVSETQLLCESPNLTGRHKVLARVGGIEFSPGVVHITSDSPLSSTAI
IGITTAGAMLILFIVIVLIAYKRKSRESDLTLKRLQMQMDSLESRVALECKEAFAELQTD
IHELTSDLDGAGIPFLDYRTYTMRVLFPGIEEHPVLRDLEVPGYRQEQVEKGLKLFGQLI
NNKVFLLCFIRTLEAQRGFSMRDRGNVASLIMTVLQSKLEYATDVLKHLLSDLIDRNLES
KNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDSITG
EARYSLSEDKLIRQQIDYKTLVVNCIHPENEKSPEIQVKALNCDTISQVKEKILDAIYKN
VPHSHRLKASDMDLEWRQGRGQRMILQDEDVTTKIEGDWKRLNMLAHYQVPDNAVMALVP
KQVTAYNSVNNSTVSRTSASKYENMIKYTGSPDSLRSRTPMITPDLESGVKVWHLVKNHE
HGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDF
LDEQADKHNIHDPHVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFM
DSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYSDISKMQAISDQDMNAYLAEQSRM
HMNEFNSMSSLSEIYSYVGKYTEEIVCSLEQDDGARKQRLAFKLEQVVAFMSLES
Download sequence
Identical sequences XP_020508327.1.8198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]