SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020515035.1.8198 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020515035.1.8198
Domain Number 1 Region: 114-200
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000848
Family Caspase recruitment domain, CARD 0.014
Further Details:      
 
Domain Number 2 Region: 7-83
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000175
Family Pyrin domain, PYD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020515035.1.8198
Sequence length 202
Comment apoptosis-associated speck-like protein containing a CARD isoform X1 [Labrus bergylta]; AA=GCF_900080235.1; RF=representative genome; TAX=56723; STAX=56723; NAME=Labrus bergylta; AL=Scaffold; RT=Major
Sequence
MAPKTKKAALADMLENLSKSDFDKFCSHLLDRREEPRVRRRQVEGKNFLQIADVLVSTFT
EAGAVKVAVELLGCANCGQEVEELVTVIAGLDSKPGTRDTARPSAGAAGVDTTSDDQHFV
DKYKLQLTDRVSHMDPILDRLLDRGVLQREAYDTIRALPTSQKKMRELYCGCLKAGTASK
DVFYQILLENEKFLIDDLNTKH
Download sequence
Identical sequences XP_020515013.1.8198 XP_020515035.1.8198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]