SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020560411.1.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020560411.1.28442
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 2.62e-99
Family Sema domain 0.0004
Further Details:      
 
Domain Number 2 Region: 1384-1509,1675-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.14e-34
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 858-949
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000248
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 1041-1121
Classification Level Classification E-value
Superfamily E set domains 0.0000000000108
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 5 Region: 949-1022
Classification Level Classification E-value
Superfamily E set domains 0.0000000000738
Family Other IPT/TIG domains 0.028
Further Details:      
 
Domain Number 6 Region: 516-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000506
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020560411.1.28442
Sequence length 1899
Comment plexin-D1 [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MPPSMEIAVLLLGVLALETRRSASALHIQQAFASPNLTNNFVVDPISRKVYLAAVNTVYQ
LNRTLILEAQKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGVVVVCGS
VYQGFCELRKMENISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFRSHGGNSRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSRLFTYDISPSDENVFKIKQ
EVKTKNKLNFVHAFIQKTYSYIAFNNDAKIGHKESQPNSVLARICLDTDNPRQLAGLESR
KLTESYIQMPLQCGSNRNIYNRLLSVYSAEINAEDASGPQPYLFGVFSKADRKSALCAFR
FGDVEEEIRQSRMNCSSSPSSDVHVLDSVNQGSGSACIQKKNLQLTPNQLDCGAAHLQHP
LALRRPLRALPLFEYSGLSSVSVDNVHNHTVVFLGTSKGRLRKLTLLSNMTMASQSTLRL
PSSEAVHPIMTFDPNDRNFLYVMTSHHMLRIRVAECDQWKSCRSCLGAGDAYCGWCTLEN
RCSIQKECAQGLLARSWISMGEGPQQCPSITLTPPEISISADIKDVGILINGTVPDLIGS
RVECEYWPGVSTVATLHLDHGPAQIQTCPLPPRENYHPILPGTDHRSISVVIKVNGTSVV
SGSFIVYDCERTGAIHSTKSCGSCLTTQWKCYWDLENHLCVSSKDESKHNLLESAASCPR
LDPSKVPPSPSGMAQDFTLSLINIQEKEKLECDFGTERRYEATWLDNSTVKCSGVTLFTN
QRSQVFFLNLRRKGDFSAQTGNKFIDSPHLIKVEVYNCGVGSSDCSQCWGREAQGHLCGW
CENSCRPRDDCQPNEDQCPAPEIHRISPLRGPVDGGTLLTVQGRNLGRKAEGVKVSIGDV
PCYLLPERYTVSVELVCRTGKSVHDRTDVVQVEVDQSGNGVSKESFSYLIPKVVSLDPQR
GSRSGGTRVTIRGEHLDIGSQVRVTVNNTLECSITEKTDQTIECIMPKAEHAHAELLEVC
VEFEEQPCQEEYLSQTYSYEKNPYITSIHPERSFLSGGRTITVAGQGFDLVQTAFMQVLE
IGRVECSVLSSFTILCKSPPSSQPQETSVQFFLNGILYVRNNPSSSEDKLEEEEGDPLTS
HFMLEYVEDPQFFTANREKLIKHHSGEPLTLIINKVPSNLELQPEEYSVMIGSYPCNISF
HNDQLFHCTINGLPSSSERELPVTVKVGNFDHIIAKVQLGGSELAIVVSIVVCCVLLLLC
TVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGI
PFLEYKQFVTRTFFPKMCSDYEKSLVQRTFENDSLGPRALPETHPLLQDWQATNTTRPNV
EEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDL
LVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQIN
KGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMHTDTICQVKEK
IIEAFYKNLPFSQWPRAEDVDLEWFDSGSNSKILQDLDNTSVMEDGRKKLNTVFHYQVPE
GASLAMSMKDKKDYTLERVKDLDTEKYVHLVLPHDELFESSKGHRHSHRKKVLPEIYLTR
LLSTKGTLQKFLDDLFKAILSIPPDCPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNS
LPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAK
EIPEYKKRVQCYYRQIQEMPPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYNYAKRYRN
QVANALEANPTARRTQLHHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_020560411.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]