SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020564133.1.28442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020564133.1.28442
Domain Number 1 Region: 148-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-98
Family Protein kinases, catalytic subunit 0.0000000000314
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-24
Family Pleckstrin-homology domain (PH domain) 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020564133.1.28442
Sequence length 482
Comment RAC-beta serine/threonine-protein kinase [Oryzias latipes]; AA=GCF_000313675.1; RF=representative genome; TAX=8090; STAX=8090; NAME=Oryzias latipes; strain=Hd-rR; AL=Chromosome; RT=Major
Sequence
MNEVSVVKKGWLHKRGEYIKTWRPRYFILKTDGSFIGYKEKPEVSGDHSLPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTSVIERTFHVDSNEEREEWMRAIQAVTNSLKSQQQDEEP
MEIKFGSPSDSSGTEEMEIAVSKSCTKVTMSDFDYLKLLGKGTFGKVILVKEKATGMYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFF
HLSRDRVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDKDGHIKITDFGLCKE
GVTDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEEIRFPKNLAPEAKALLAGLLKKDPKQRLGGGPDDAKEVMTHKFFISINWQDVID
KKLVPPFKPQVTSETDTRYFDDEFTAQSITITPPDKYDSIDPEDSDQRTHFPQFSYSASI
RE
Download sequence
Identical sequences H2MGP2
8090.ENSORLP00000017781 ENSORLP00000017781 XP_011481238.1.28442 XP_020564132.1.28442 XP_020564133.1.28442 ENSORLP00000017781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]