SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020613163.1.65938 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020613163.1.65938
Domain Number 1 Region: 9-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000109
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 84-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000128
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 47-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000335
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 4 Region: 123-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000022
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020613163.1.65938
Sequence length 177
Comment fibropellin-3-like [Orbicella faveolata]; AA=GCF_002042975.1; RF=representative genome; TAX=48498; STAX=48498; NAME=Orbicella faveolata; AL=Scaffold; RT=Major
Sequence
MFVASKRRDIDDCVNHTCNNGGSCIDGVNNYSCNCLVGFTGDYCELDIDDCINHTCSNGG
SCEDGVNSYSCNCLVGFTGNHCETDIDDCINHTCSNGGSCVDGVNNYSCNCLVGFTGDYC
ELDIDDCVNHTCNNGGSCEDSINSYSCNCLTFTTVLITHVVMVDPVRMVSTATLVTA
Download sequence
Identical sequences XP_020613163.1.65938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]