SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020668846.1.8467 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020668846.1.8467
Domain Number 1 Region: 47-452
Classification Level Classification E-value
Superfamily Sema domain 1.7e-82
Family Sema domain 0.0035
Further Details:      
 
Domain Number 2 Region: 1322-1445,1611-1763
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.02e-35
Family p120GAP domain-like 0.019
Further Details:      
 
Domain Number 3 Region: 796-876
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000252
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 4 Region: 886-975
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000887
Family Other IPT/TIG domains 0.062
Further Details:      
 
Domain Number 5 Region: 975-1066
Classification Level Classification E-value
Superfamily E set domains 0.0000000000187
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 6 Region: 455-507
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000379
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020668846.1.8467
Sequence length 1835
Comment plexin-D1 [Pogona vitticeps]; AA=GCF_900067755.1; RF=representative genome; TAX=103695; STAX=103695; NAME=Pogona vitticeps; AL=Scaffold; RT=Major
Sequence
MVAAPRDPCGGASQVRCPGARRASFFLLLPLLLLLLLPEAGRGLRVQHKFVSPTLTNNFA
LDGSGDKIYLAAVNRLYQLSGPNLTLEVEEQVGPKEDNPLCHAPQLPQATCEHAKKPTDN
YNKLLQPDPEQGILVVCGSVYQGFCQLRSMDNISVVAVAFPPGSGAGAGAEGGDQVTVFP
SMLNVAANHANASTVGLVLRQGGQDTRLLVAATYTGLGSPFFPRNASLEDHRFENTPEIA
IRALNTRGDLARLFTFDINPSDDNIFKIKQGAKERHKLSFVSAFLHRGAHPPSALCVFRF
AEIEEAIRVARNSCFVAPDARLVTVLDSVVQGTGPACEKRKIQLQPEQLDCGAAHLQHPL
SILQPIKARPVFTSPGLTSVAVSSINNYTVVFLGTANGRLLKINLNSSMEVISRESVTVA
YSEPVHPIMQFDPSDSSYLYLMTSHQIARVKVAACDQYATCTECLAAADAYCGWCSLETR
CSLQHECANSDEPYYWISANEGVQQCPSMTIITSEINIDRENEGMIIQINGNIPSLNGME
MSCDYGNNIQTVAKVAAQSWNQFVYCNFLPREKYPPFPSNQDHVIVQTAVRVNGKNIVWA
NFTIYDCKRTGNIYPKTACINCLSAKWKCYWCTKKYSCVSNASECEDSILMNNSTDCPQI
VPASVAPVSTGVSQDITIMLRNAAFIKDMPLECHFETDRIFEARWENTSTIQCSNVLLYT
SNKRHLFPVNLQLKEKPGRFIDSPQMMTVEIYNCATGSADCSQCLGREDLGHQCTWSESS
SSCRLNTESVQSPGMCPPPEIRKIEPLSGPLEGGTLVTIRGRNLGRRFSDVVNAVRIGNV
KCSPLQDRYIVSEEIVCWAGEALTEFTDVVTVNLSKEGKSRERYSYVLPVVKFMSPSTGP
KAGGTKVTITGHNLSVGSELRVLVNGTKECTDISRTDTTITCTMPSVEATTTASICVQFE
NKSCIGENNNFNYEKNPSIMDINPKKSQISGGRIITVEGNGFLMAQNVSMVVHTIGKEQT
NCKVHSDTMITCPSPAASNLTGSKPTSVDFYINGRLYTDDSLFLFEHPEEAIHISKFLLE
YYPDPQFFTAKKEKWIKHHPGEPLTLVIHKEPDNLGLESNEYEVKIGLISCEIQIVSDKV
IHCSVNESLSTSERQLPVTIQVGKFNQTIAMLHLGGSETAITVSIVICSILLLLSVVALF
VFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEY
KYFVTRTFFPKCSSLYEERYILPSQQLNSQMGSQVQETHPLLLGEWKIPENCRPNMEEGI
ALFSTLLNNKHFLIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDL
IDASASKNPKLMLRRTESVVEKMLTNWMSICMYSFLRETVGEPFFLLLCAIKQQINKGSI
DAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLTVRVMDTDTLSQVKEKILEA
FCKNIPYSQWPRVEDVDLEWFATSTESYILRDLDDTSVMEDGRKKLNTLAHYKIPDGASL
AMSLTDKKDTTLSRVKDLDTEKYFHLVLPTDELNENKKSHRQSHRKKVLPEIYLTRLLST
KGTLQKFLDDLFKAVLSIRDEKPPVAIKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLR
FWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPE
YRKIVQKYYKQIHDMPPLSEQEMNAHLAEESRKYRNEFNTNVAMTEIYKYAKRYRSQIVN
ALDTNPTTKRTQLQHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_020668846.1.8467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]