SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020706591.1.80111 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020706591.1.80111
Domain Number 1 Region: 575-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.14e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 145-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000128
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 318-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000247
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 492-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000354
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 546-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000203
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 6 Region: 625-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000231
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 433-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000477
Family Classic zinc finger, C2H2 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020706591.1.80111
Sequence length 1094
Comment zinc finger protein 91 [Athalia rosae]; AA=GCF_000344095.1; RF=representative genome; TAX=37344; STAX=37344; NAME=Athalia rosae; AL=Scaffold; RT=Major
Sequence
MDVAGDLTLQWVEEVGNVVHEEVICGLEADLTTPEEEVIGACEEVSVEDTVETVTESCPA
PDSEILLVPQSNDMESIYIVPQDGQGHDYLNIQVTEEVITDNWDRPGQHDGIDIPETKVS
HDNLLEYDDMEIPLPIDQDSYTNTRPYPCDFCSRRFRKKANLMNHMVAHQTDRPHGCNLC
GARYVRKCDLMNHLKIHAYAPSRDGLDDDLNDDDSLVPDEEETNKGRRKKVQSSAPRKRK
NNAAAAKRAAPEIKVEMGKYVNKSYDYVDEDMRLLEEMTTRNSARGNNYASSSRWGDQMS
PELTEPQPPRWPITDPTKPYVCQHCGVGFAREKALASHARVHGGDSPFECTSCGDMFWDV
NTLREHVRTKHAGTVQSDLEEYDNDATYTGDERFGEFYCDTCGVPFHRLDLLKRHRKIHV
KQENDVMTEGSSQHHVCNVCGEWFQEALALLAHAELHARSPTRRCLLCGQRCRDDAEVAE
HVRQVHAEDAPPNTCTLCGKTCKDKRSLIKHSWVHNADKTFGCTKCGKRFHSKARLRRHM
VSHRNKMVACDECGEEFPDGRALVSHRHSHNKDLGGRSFPCRECGKTFGSRSSQQIHIRI
HTGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSG
PDPKCHGSMTPYLCKVCGESYATSEEIVAHIVQHCDDNTALRRQPQTGPRKYKRRRKLKP
YETNAIPPRMAVSFETPEVASDSDDNTKRKLGKKNKQQHRSNVEEGYQNVLKSFESSLQN
ISSIVSNSKANPAKSKVSKKKLKKEEKKSETQTSAQTGRPKMIHTQKTRVPVQVGGDGVK
RGQKTKTMVTRTPKVMPNEHKTGIFPGGERNRPRTKNVSYHIEGKLQLTSATFPKPNDEA
EKLQVTFTDNVKLEPGLQKSSGIHSNNNGNIVAVTPKAEPVPRKKAVVVKRMKKQKQVVI
KEEPKDEDMSQHSSQNNNNPLENNQITHMMDHGMDGNNLEVAYETSIANAVEESILPDLE
VPVDHEEIEKENFQISVKMLEATPNRMLTVHHVITPVDEVPETIIPDALEYTCEMCSAVF
SSRAELLVHVPIHI
Download sequence
Identical sequences XP_012251402.1.80111 XP_020706591.1.80111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]