SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020707164.1.80111 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020707164.1.80111
Domain Number 1 Region: 599-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.38e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 640-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000155
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 560-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000256
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 379-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000194
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 215-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000126
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 496-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000145
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 7 Region: 467-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000261
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020707164.1.80111
Sequence length 803
Comment zinc finger protein 93-like isoform X2 [Athalia rosae]; AA=GCF_000344095.1; RF=representative genome; TAX=37344; STAX=37344; NAME=Athalia rosae; AL=Scaffold; RT=Major
Sequence
MDVEIEGSIALENLDRVCRVCLSTDGNNQYIFQDDIGEKEVGDTFTLSQKLQVYGGIEDQ
DCQTDTSSLCTPVKKELSSAVKEDFDKIKKENILNTNSYPNSVTSTEALRDTCQKDIEIH
EHKILLADDFGPCRSIEKEKTSFKKDSACRSRRIAVFKRITSIQNLKSHRERQRQYIKKN
PTSRSESNDQEFSNRNIRKRAIRPAIINFQAEFSHKCNKCSRSYATKTSLERHMLTHNDK
KFKCDKCCKHFVRLDKLIEHGKLHDPEVRPNPVSCKICDKNFRKTDTMVRHLNVHKKANP
KEVFSILKDIRDKRRSEDAGKDEKRLLTKEESSSGDETETVETSGLVPKSTNSRAYNPES
PNSDSHSSSEPYSLNSLAFYRCKHCTKCYSTNKSLQRHMLIHDEKKFVCNVCNMKFFRPD
RLKSHRDRYGHDEDKECMEPQKPPDDKSAIKLINSWIREQLDSDNEGKGFPCDVCGKSYV
TKKSLQKHRANIHASKTNICTVCGEDCKCLEKSNNDDNKIDKSKPYSCDECDKSFEKESK
LKTHLRIHERAKEQQDSNFKRFLCHICSKTFRQNTGLMFHMRTHTGYKPHVCKYCGRGFT
SNSNCINHERTHTGDRPFVCHFCSAAFAKSCTLKAHITTHTGEANYHCKTCGKSFRRLKY
LKEHSFTHTGEKPYACKICGTAYSHSGSLFVHEKKCKAQYSNYQNVSSQNTQNYVQLQTG
VNVSPIVAPIIPMLSASSNLNNVNNTLGSHGQKSYIENMQRMSAHVAAAAAVGNPGLHMH
SNSDVSEMASAVRSFTITQVFHS
Download sequence
Identical sequences XP_020707164.1.80111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]