SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020717318.1.71379 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020717318.1.71379
Domain Number 1 Region: 724-869
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.29e-36
Family Toll/Interleukin receptor TIR domain 0.00015
Further Details:      
 
Domain Number 2 Region: 144-356,392-485
Classification Level Classification E-value
Superfamily L domain-like 2.21e-25
Family Ngr ectodomain-like 0.042
Further Details:      
 
Domain Number 3 Region: 542-657
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000000104
Family Ngr ectodomain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020717318.1.71379
Sequence length 899
Comment protein toll-like [Ceratitis capitata]; AA=GCF_000347755.2; RF=representative genome; TAX=7213; STAX=7213; NAME=Ceratitis capitata; AL=Scaffold; RT=Minor
Sequence
MKQPAIVLLTIIYALEPHGVQAKAESSLALLTELCESEVCECDGVIFECELVGVFSLITV
SGKTSWSETEERRAVVYAINITCVYEPQNLDAVLNIMPQVQLCYRTEFYLKNCLAYPALL
QQPNITYEGTVEFDQYLLTPTQFFNQTRELTTLRLPVKFIHTAHPLPESLLHNLTNLKHL
ELAASSTFEEISWPLALWHTLYNLETLSIQLVALHTTVRGMQSAHFRDLRALKQLKLEAT
HMMTLSGELFTSLGELNRLSLRLNSLEELPPDLLRMQHKLVVLDISENRLQALPRGFFNN
TPLLWELILSNNLLSMPTNIIENVQTLSYLRKLDLGYNRLPSIWGTGAYRNSTIFTRQRI
AEPFDLANFIDMIGDFTSSQKSSVESLNQTAIILRNNQITHFSLEWLAAAGIRCPYYLDL
AFNEIRHVHAIFSASASTTCQSVLHLINNPLACDCELAWVYGTNILLNGVRWQCASPERL
YGYDLQNLERADMCAWTPAWCPLSCSCTKSESSVLIINCNAARLRILSQIPRPDQLSLAE
STLYIEHNLFGELPSNATFGYANVTRLYASHNRLNIVLPSHLPPLLRVLDLRANQLPQLS
AGFLSNYLNNSATLTKLYLSGNPWMCDCNTELLLYTLRTQRKRIPDVDDLYCANYPNMTL
LNVSFNDICKRPPSGSALITKLIITFLTILTLLLVLTLYYKYELELKIWLHAHNMTLTCC
SVEELDRDKTFDAFISYSHMEADYVNRLLVPGLEREAPYFRVCTHERNWLAGAYIPEQIV
ESVAQSRRTIIILSEHFIASDWARMEFKTAHQFAVNERRARIILIKYGVVENMDGLDAEL
QAYLRMNTYLDSEDPRFWQKLRYAMPHKRGEAHKAGMLEVRGRVYVRGQVELNQLASRK
Download sequence
Identical sequences XP_020717318.1.71379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]