SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020728182.1.74333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020728182.1.74333
Domain Number 1 Region: 76-572
Classification Level Classification E-value
Superfamily Sema domain 1.83e-99
Family Sema domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1436-1561,1727-1883
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-34
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 1004-1094
Classification Level Classification E-value
Superfamily E set domains 0.000000000000072
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 4 Region: 913-1004
Classification Level Classification E-value
Superfamily E set domains 0.000000000000095
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 5 Region: 1092-1172
Classification Level Classification E-value
Superfamily E set domains 0.000000000042
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 
Domain Number 6 Region: 575-626
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000576
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020728182.1.74333
Sequence length 1951
Comment plexin-D1 [Odocoileus virginianus texanus]; AA=GCF_002102435.1; RF=representative genome; TAX=9880; STAX=9874; NAME=Odocoileus virginianus texanus; AL=Scaffold; RT=Major
Sequence
MWEPPPSLRPSSERLELARPGRRVGRAGPRGARPRAARGGGTHPPFRAPRCPPPPPLLLW
LLLLLGAARIGALEIQRRFPSPTPTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAA
VGPVADSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRG
NISAVAVPFPPAAPPAAPVTVFPSMLNVAANHPNASTVGLLLPPAAGAGGSRLLVGATYT
GYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQ
HKLGFVRAFLHPPDPRPGAQTYAYLALNSEARAGDKESQARSLLARICLPRGAGGDAKKL
TESYIQLGLQCAGGAGRGDLYSRLLSVFPTRELLFAVFERPQGSPAARAAPAALCAFRFA
DVQAAIRAARTACFVDPAPDVVAVLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPL
SVLQPLKALPVFRAPGLSSVAVAGVGNYTVVFLGTVSGRLLKINLNESMQVVSRKVVTVA
YGEPVHHVMQFDPSDPGYLYLMTSHQMARVKVAACAAHTTCGDCVGAADAYCGWCALETR
CTLQQDCANSSQPHFWTSASQGPGRCPAMTVLPAEISVHQDYPGMILQISGSLPSLSGMD
MACDYGHGIRTVARVPGPAFGHQIAYCNLLPKDQFPPFPPHQDHVTVEMSVRVHGQNIVR
ANFTIYDCGRVGQVYPHTACTSCLSAQWPCFWCTQQHACVSNQSRCEASPNPMSPQDCPQ
ILPSSLAPMPTGGSQSIPVHLANAAFFQGAALECSFGPEETFEAVWVNESAVRCNQVVLH
TTQKSQVFPLSLQLKGRPARFLDSPDPMTVEVYNCAVGSPDCSQCLGREDLGHLCVWSDG
CRPRGTLQPPPGTCPAPEIRAIEPLSGPLDGGTRLTIRGRNLGRRFSDVAHGVWIGSVAC
EPLADRYTVSEEIVCATGPAPEAFSDVVTVNASKEGRSRERFSYVLPLVRSLEPTMGPKA
GGTRVTIHGSDLHVGSELQVLVNDTEPCTELLRSDASIACTVPGGALPATVPVCVRFEQR
GCVRGGLSFQYMPNPVITAISPHRSHVSGGRTITVAGERFHMVQKVSMAVHHIGREPTLC
KVVNSTLITCPSPGALSNASAPVDFFLNGRVYADEAAVAEQLLEPEEAQRGSQFRLDYLP
DPQFSTAKREKWIKHHPGEPLTLVIHKEQDGLGLESHEYRVKIGQVACDIQIVSERVIHC
SVNESLGTAEGQLPITIQVGNFNQTIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFC
TKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHF
VTRTFFPKCSSLYEERYVLPSQTLNSQGSSPVQETHPLLGEWKIPESCRPNMEEGISLFS
SLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTGIMKELLVDLIDAS
AAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAIT
GKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKN
VPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSL
TDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTL
QKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVN
ILKNPQFVFDIEKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKI
VQRYYKQIHDMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMSALEA
NPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_020728182.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]