SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020737629.1.74333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020737629.1.74333
Domain Number 1 Region: 309-751
Classification Level Classification E-value
Superfamily Sema domain 9.94e-115
Family Sema domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1603-1716,1893-2079
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.33e-44
Family p120GAP domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 1090-1184
Classification Level Classification E-value
Superfamily E set domains 8.53e-17
Family Other IPT/TIG domains 0.0058
Further Details:      
 
Domain Number 4 Region: 1182-1272
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000967
Family Other IPT/TIG domains 0.049
Further Details:      
 
Domain Number 5 Region: 756-805
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000166
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 1270-1382
Classification Level Classification E-value
Superfamily E set domains 0.0000955
Family E-set domains of sugar-utilizing enzymes 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020737629.1.74333
Sequence length 2112
Comment plexin-B2 [Odocoileus virginianus texanus]; AA=GCF_002102435.1; RF=representative genome; TAX=9880; STAX=9874; NAME=Odocoileus virginianus texanus; AL=Scaffold; RT=Major
Sequence
MIAWEGGLCREPGGLLGTDCSAAFWESGLEQGAHVQTPSGPAAGWSCGLLGSAPPDFGQE
EASGAPEEIPTALVSKRGSRAAFKTGSARSGNTSRRELCRLLLAPPVRRPERGFWKWREL
PPGVPAPPVTPYNLGSREGLTLPAAQRAPGAGXPGRPPPGLGAAPAGARAPGPLRPWTGG
WPSPTSGGLPGVLFPRAGSPARRARPDCALVGPVLRAGLRNLPAPPQPDWSPRGPVTLAA
PPSASSWATSAPFPGPCCLPRDVVPSACGWLLSQQLVRSPGGTGAMALQLWALTLLGLAG
TSVSLRPRKLDFFRSETELNHLVVDEASGMVYVGAVNMLYQLSADLQLEQRAATGPALDN
KKCTPPIEVSQCHEAVLTDNVNQLLLLDPPRSRLVECGSLFKGICALRALGNISTRLFYE
DGSGEKSFVASNDESVATVGLVSAAGPGNECLLFVGKGNGPHDNGVIVSTRLLDRTEGRE
AFEAYTDHATYKAGYMSSNTQQFVAAFEDGPYVFFVFNQQDKHPARNRTLLARMCKQDPF
YYSYLEVDLSCRDPGDAQAPPFGTCLAASVDRPGSNRVLYAVFSRDGRGSGGPRTGLCLF
PLDEVHRKMEANRDACYTGAREVARDIFYKPFHGDIQCGGHVSGASESFLCGSEHLPYPL
GSRNGLSAKAVLHRGGLNLTAVTVTTENGHTIAFLGTSDGRVLKVYFAPDGSSTEYGAVL
VEINKRIKRDLVLAADRASLYAMTQDKVFRLLVQECASFSSCSHCHGSQDPYCGWCVVEG
RCTRKAECPRADESGHWLWSRNESCVAVTGAHPQNMSRQTQGEVQLTVSPLPALSDDDTL
LCLFGGSPPHPARLQEGTVVCNSPSRSSLPRTPPGQDHVAVTIKLLFKRGNVFLTSHRYP
FYDCQEAMSLKENLPCISCTSNRWTCQWALREHACQQASPSPEDGVVGAHMEDDCPQFLN
PSPLVIPVNHETDVTFQGKNLDTVQGSPLLVGSDLLKFEASVSTQEPGTFSFRTPKLMHD
ADETLPLHLYVKSSGKNVDSRLQVTLYNCSFGRSDCSLCLAAEPAYHCVWCSGQSRCVYE
ALCGNATSECPPPVVTRIQPETGPLGGGIRVTILGSNLGVRADDVKRVTVAGQNCAFEPE
RYSVSTRIVCTMEAAEVPFTGGVEVDVNGKLGRSPPGVLFTYQQPQPRSVEPRQGPQAGG
TTLTINGTHLDTGSEEDVRVTLNDVPCNVTQFGAQLQCVTGPQSVPGELALKIYYGGSEV
PSPGITFTYRENPVLRAFEPLRSFVSGGRSINVTGQGFSLIQRFAMVVIAEPLQSWRRRR
ETGPLQPLTVVGTEYVFYNDSKVVFLSPAVPDEPEAYNLTALIRMDGHQALLRTEAGAFE
YVADPTFENFTGGVKKQVNKLIHARGTNLNKAMTIHEAEAFVGAERCIMKTLTETDLYCE
PPEVQPPPKRRQKRDTAHNLPEFIVKFGSREWVLGRVEYDTRASDVPLSLILPLVIGPMV
AVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEMEDQTNDVHEA
GIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPESRRPVVEQALYQFSNLLNSKCFLI
NVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMS
ICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYTPLMVS
VIVQDEGVDAVPVKVLNCDTISQVKEKIIDQVYRTQPCSRWPKADSVVLEWRPGSTAQIL
SDLDLTSQREGRWRRVNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGERHALLEEEN
RVWHLVRPADEVDEGKCKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSVLAP
GNAVPPAVKYFFDFLDEQAEKHDIKDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHE
VVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVS
DQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEIINALEEDPAAQKMQLAFRLQQ
IAAALENKVTDL
Download sequence
Identical sequences XP_020737629.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]