SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020750898.1.74333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020750898.1.74333
Domain Number 1 Region: 303-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.82e-16
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Domain Number 2 Region: 266-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000458
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020750898.1.74333
Sequence length 387
Comment early growth response protein 3 isoform X1 [Odocoileus virginianus texanus]; AA=GCF_002102435.1; RF=representative genome; TAX=9880; STAX=9874; NAME=Odocoileus virginianus texanus; AL=Scaffold; RT=Major
Sequence
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVAHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCSDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSMPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKAEKGGAPSASSAAPVSLAPVVTTCA
Download sequence
Identical sequences E1BBZ7
ENSBTAP00000025687 9913.ENSBTAP00000025687 NP_001276747.1.59421 NP_001276747.1.76553 XP_006041006.1.26621 XP_019821889.1.53367 XP_020750898.1.74333 ENSBTAP00000025687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]