SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020754930.1.74333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020754930.1.74333
Domain Number 1 Region: 54-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-28
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 2 Region: 262-376
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000034
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 465-502
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 175-212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 221-260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000122
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 426-463
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020754930.1.74333
Sequence length 781
Comment low-density lipoprotein receptor-related protein 3 isoform X1 [Odocoileus virginianus texanus]; AA=GCF_002102435.1; RF=representative genome; TAX=9880; STAX=9874; NAME=Odocoileus virginianus texanus; AL=Scaffold; RT=Major
Sequence
MPLAMTTLAGLDPTWERPVLGSWAGGLNVPLPHCPLPPKGEASTSQPPLLTAACSGKLEQ
HTARRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPA
APPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQAD
EFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLP
AERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQ
DPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHA
RARSAGHGFNATYQVKGYCLPWEQPCGSSREGDVEDPGEQGCFSEPQRCDGWWHCASGRD
EQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIF
ETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQE
YRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQ
MRRHASRRGPSRRRLGRLWNRLFHRPRASRGQIPLLTAARTSQTVLGDGLLQPAPGAARE
PLAPLTDTSSPGAAGEGPPGAPSHASEVGPSAPPPSGLRDPSESRLAGKDRKAGRDPLVD
SPAPVDVPQESCSGQDPYPPALTAGGIPGPHPSEPLGVCRSPPPPRSPTLEASDDEALLV
C
Download sequence
Identical sequences XP_020754930.1.74333 XP_020754931.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]