SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020755711.1.74333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020755711.1.74333
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-40
Family Dual specificity phosphatase-like 0.000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020755711.1.74333
Sequence length 173
Comment protein tyrosine phosphatase type IVA 3 [Odocoileus virginianus texanus]; AA=GCF_002102435.1; RF=representative genome; TAX=9880; STAX=9874; NAME=Odocoileus virginianus texanus; AL=Scaffold; RT=Major
Sequence
MARMNRPAPVEVSYKNMRFLITHNPTNATLSSFIEDLKKYGATTVVRVCEVTYDKAPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLLKNKFCDDPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHAHKTKCCIM
Download sequence
Identical sequences A2VDT1
ENSBTAP00000056281 ENSBTAP00000056281 NP_001077235.1.59421 NP_001077235.1.76553 XP_005215180.1.76553 XP_005215181.1.76553 XP_010810118.1.76553 XP_015329814.1.76553 XP_020755711.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]