SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020762469.1.74333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020762469.1.74333
Domain Number 1 Region: 55-322
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.78e-29
Family G proteins 0.026
Further Details:      
 
Domain Number 2 Region: 444-533
Classification Level Classification E-value
Superfamily EF-hand 3.42e-22
Family Eps15 homology domain (EH domain) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020762469.1.74333
Sequence length 540
Comment EH domain-containing protein 4 [Odocoileus virginianus texanus]; AA=GCF_002102435.1; RF=representative genome; TAX=9880; STAX=9874; NAME=Odocoileus virginianus texanus; AL=Scaffold; RT=Major
Sequence
MFSWLGRQAGGRGGTGADPVQTVTGGLRSLYQRKVLPLEEAYRFHEFHSPALEDADFENK
PMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGNTPGNALVVDP
KKPFRKLGRFGNAFLNRFMCSQLPNEVLKSISIIDSPGILSGEKQRISRGYDFCQVLQWF
AERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMW
SLGKVINTPEVLRVYIGSFWTQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLI
KRARLAKVHAYIISFLKKEMPSMFGKENKKRELISRLPEIYIQLQREYHISAGDFPKVKA
MQEKLENYDFTKFHSLKPKLIEAVDNMLTNKISSLMNLISQEEMSMPPPLVQGGAFDGTA
ESPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGINAKKEMVTSKLPN
SVLGKIWKLADCDGDGMLDEEEFALAKHLIKIKLSGYELPSSLPPHLVPPSHRKSLSKAD
Download sequence
Identical sequences E1BJV0 L8I2E7
ENSBTAP00000008933 9913.ENSBTAP00000008933 ENSBTAP00000008933 NP_001178982.1.59421 NP_001178982.1.76553 XP_005904035.1.15283 XP_006066276.1.26621 XP_010846309.1.44457 XP_019824147.1.53367 XP_020762469.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]