SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020778012.1.12261 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020778012.1.12261
Domain Number 1 Region: 27-515
Classification Level Classification E-value
Superfamily Sema domain 1.03e-100
Family Sema domain 0.001
Further Details:      
 
Domain Number 2 Region: 1393-1516,1682-1834
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.39e-34
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 855-947
Classification Level Classification E-value
Superfamily E set domains 2.93e-16
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 4 Region: 945-1027
Classification Level Classification E-value
Superfamily E set domains 0.00000000000117
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 5 Region: 1038-1117
Classification Level Classification E-value
Superfamily E set domains 0.0000000000853
Family E-set domains of sugar-utilizing enzymes 0.028
Further Details:      
 
Domain Number 6 Region: 517-570
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000314
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020778012.1.12261
Sequence length 1906
Comment plexin-D1 [Boleophthalmus pectinirostris]; AA=GCF_000788275.1; RF=representative genome; TAX=150288; STAX=150288; NAME=Boleophthalmus pectinirostris; AL=Scaffold; RT=Major
Sequence
MPPSIEIAVLLLSVLALETRRGASALYIQQAFASPNHTNNFVVDPVSGRVYLATVNTVYQ
LNGTLSLEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGVVVVCGS
VYQGFCELRKMDNISEIAVEFPPHGEKTVFPSMLNIAANHPNASTVGLIFRSHGGNTRLL
VGATYTGAGTQYFPKNHSKEDLRFENTPEIAIRSLNVKDLSRLFTYDINPSEDNVFKIKQ
EAKTKNKLNFVHAFIQKTYSYIAFNNDAKMGHKESQPNSILARICLDTDNPKKPSGPESR
KLTESYIQMPLLCGSNGNIYNRLVSVYHVNIPTEERSSPEPYLFGVFSKADRKSALCAFK
FSDIEEEIRQARRNCSNSPSSDVQVLESVIQGSGAACIQKGSLLLQLQPDQLDCGAAHLQ
HPLALRRSLRASPLLETPSLTSVSVDHVHHHTVVFLGTSSGRLRKLTLLPNLTLVNQWTL
KLPALESVHHIMTFDPTDRNFLYVMTSNHMLRVKVAQCDQWKSCGDCLGAGDAHCGWCTL
ENRCSLQKDCSLGVSPRSWISLGEGPQQCPSMTLTPPEISISADIKDIGILINGSVPDLI
GSRVECEYGPGVSTAATVHLDYGPAQIQTCPLLPRENYQPILPGTDHLTVSVAIKVNGTA
VVSGNFIVYDCERTGAIHPKTSCGSCLSTRWKCYWDLESHLCVAGKDESKHNLLEDAAFC
PSLVATEVPPSPSGMSQDFTIFLNNVEEGEQLECDFGTDQRYEATWLNSSAVKCSGVTLS
THQRTQVYYLNLRRAGDFDVFIDTPNPMKVEVYNCAVGSSDCSQCWGREDQGHLCGWCDN
SCKPRDDCQPIRDQCPAPEIYKIFPLKGPVEGGTLLTVQGKNLGRRAQEVAVTIGDVPCV
LQTSLYTISEQLVCVTNSSAGEMTDFVQVEVNQSKVGTSRETFSYLAPKLLSMYPVKGSR
AGGTRVTIRGEHLDIGSEVRVTVNNTEECIITQKTDDTIECTMPPALQPHTDSALVCVEF
ENVPCQLERVSTMYTYEKNPIISAIHPTKSYLSGGRTITVTGQGFDLVQSVSMQVLGIGP
SLCAVLSTSLITCPSPAAIQSQQTSVQFYLNGVLYTGDSPASSDSGEGADEEDEEEEEEE
SDVLKGHFLLEYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPNDLELVPEEYSVMIGSY
PCNISFHNDQLFHCTINEPLSTSKSELLVTIQVGNFHQTIAKVQQGGSELAIVVSIVVCC
VLLLLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKEL
NRSQGIPFLEYKQFVTRTFFPKMSLDYEKTLVLPVVYENDSLGPKALPETHPLLQDWQSN
NSTKPNIEEGIALFSTLLNNKHFLVTFVHALEQQKDFAVRDRCNXASLLTIALHGKLEYY
TSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLC
AIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDT
ICQVKEKIIEAFYKNLPFSQWPRAEDVDLEWFDSGSNSRLLQDLDNSSVMEDGRKKLNTV
FHYQIPEGASLAMSMQDKKENTLGRVKDLDTEKYVHLVLPHDELMETRKKHRQSHHKKVL
PEIYLTRLLSTKGTLQKFLDDLFQAILSIPLDRPPLAVKYFFDFLEEQADKRGITDPDTL
HIWKTNSLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPT
NKLLYAKEIPEYKKRVQWYYNQIQEMPPLSEQEMNAHLAEESRKYRNEFNTNLAVTEIYK
YAKRYRNQVVNALEANPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_020778012.1.12261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]