SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020798441.1.32911 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020798441.1.32911
Domain Number 1 Region: 642-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 151-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000326
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 361-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000758
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 4 Region: 695-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000382
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 497-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000574
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 6 Region: 559-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000923
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 613-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000272
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020798441.1.32911
Sequence length 1323
Comment uncharacterized protein LOC110176433 [Drosophila serrata]; AA=GCF_002093755.1; RF=representative genome; TAX=7274; STAX=7274; NAME=Drosophila serrata; strain=Fors4; AL=Contig; RT=Major
Sequence
MNNQDYGGIQWIQHHPAAGDSSETDIMEHEDADGDDMVSGADGDPDGDGDADADLDHMAA
ENLIFMARDGQLGEIIAANEGTVLVTADGTTVAYAESFDDDAQVVTEEVITDDWVQHQGA
ERVEIAAEQIAGIGSSQELLDMEQDEYTALRPYPCDFCSRRFRKKASLNNHMLAHQNDRP
HLCKLCGARFSRRAELISHFKAHAEAQDAADAEAAAAAAVSSSIKFENQGQRQIDDHYYE
QEWPLYQQQQQDQEQEQVQHEQMLQQEQQQLVCNNEVQFVASYTASVAPPPAPSRGRISR
LKPKEESSQFVVITDKPASSELHDYMTSEPVPQPVVPTSQPMAIDPPPAPQPNFPVLDES
KPFVCQQCGLAFAREKALVSHTKNHRVDSPFECNQCQEMFWDNSSLQDHQKTHQFEESNS
EYDPASGDDSASETSEPEDQLYGEFYCNECGISFHRQDLLRRHAKQHFKQQEQNSTVAAG
DGSSSDVIASCEQTKDGNGGHCCQTCGKSFPSALEMLSHAEIHARFPPFKCVLCGISFYE
EQAIKRHLHTRHPNELKANSCVLCGKECRDRKALIKHAWDHSREKCHSCSKCGKNFHNKA
RLKRHMASHRDKSVVCEVCQEEFPDGRTLSNHRHSHSTTSPGKLFPCHECGKTFGSRSSQ
QIHVRIHTGERPYGCRYCWKAFADGGTLRKHERIHTGEKPYACSVCPRAFNQRVVLREHI
RSHHSGLDVARNTYHCTVCSEDLASSNDLIQHLIQHSDSNTAKQRQPVTGPRKYKRRRKL
QPHEIAHMRAEHKDANGGGDEEEVLGGGGDGDGEEYASDIDLCDFDVENVDDLFEMAESS
PKKEKRKRKSAAASAKTESKPVSNGGASSAKLVQEKNTAKLRYDSTSSQQSDRIWEEKFL
QDSQVGLFQIDSLVVVNDTHLPPASSSVMPKTRGSSKQQQQQQHQAKQPVERAGNSNPSA
ASSVATSSASASTSTSSSRSRKKTAAVKTAAASRPRMIHTEKAKVPSRGNTGGDLCKKTR
SKTYITRTETSNLSSLDKSRSRASNIVDDYEIISPATHPPNQISSSPLHIKQEQEQHNRV
QMMYDDNLLIDAALLREKTYEKFNPSIVNDLEEILRSPLKHERNTRLRFTSESSTTPQFL
PEEEQNLIKIEPTSPDLHEMLESQSQRVRVPSGNTPSPSSSSAARTSRHRIVNANGPRTA
NKRSAGGGGASSASKSSPATGVAAKKVITADSKVGSSSSYLNYGVDAYNVNVPASSSTAD
VGSGFFSISEVVSAADAADAADAAAKAAAAGKPDRKTRSFECEMCSAIFYDRAQLLDHVH
IHI
Download sequence
Identical sequences XP_020798441.1.32911 XP_020798442.1.32911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]