SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020813841.1.32911 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020813841.1.32911
Domain Number 1 Region: 842-984
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.22e-32
Family Toll/Interleukin receptor TIR domain 0.00044
Further Details:      
 
Domain Number 2 Region: 166-442,584-654
Classification Level Classification E-value
Superfamily L domain-like 4.15e-16
Family Ngr ectodomain-like 0.057
Further Details:      
 
Domain Number 3 Region: 711-781
Classification Level Classification E-value
Superfamily L domain-like 0.00000109
Family Ngr ectodomain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020813841.1.32911
Sequence length 987
Comment protein toll [Drosophila serrata]; AA=GCF_002093755.1; RF=representative genome; TAX=7274; STAX=7274; NAME=Drosophila serrata; strain=Fors4; AL=Contig; RT=Major
Sequence
MESIWLKFYIILVSINSSLSAKLLENIAENYCEAYCGGTCNDEKTNKTCDDEDRNFIVTN
EYQLKFIDGELEIQWNYPHVKGCNITPITQEKNKKLKVLIVTERIRDCRGADYLRQLGVE
TVNRFELHEDVFRAFERRVHYMDGPQSLTFNFLGPVLFHKIRNYMEVSMNNLQEIIINGD
NLTGSKAVEIDDDIFREKPQLKSIAFGGFNIYNLKEEVFFPVVSLEKLELSNVIIENFSL
ISLNPLQNSLQQLVLNIPQEVDLKHFKTFSQLKLIKVRNYISYDNLTALMCTPTECKFDR
GINGIACPDVCDCRYNYGFMELEMNCSSRGLTQIPPLPIPIIGDSKLIFENNSLSKLPDS
SLMGYSNLRGLNVAGNLLSNLSIRHLPNKLNYLDIRFNNVKQMKSDVIEYIRNVSIFKQT
GNQWLVYCNDDPLLNLFRNLKKSMRMKANKLRPILIHLSPQSPEGFLKYLGQHFLRLGST
RRGYFMINEDKLVRSMLQKVEDLDKQMYIRESMEWLHRSLPSVNEEYESFYHYHMGGVCP
YKCECCQYHNETNIKVDCKNRFMINFPDINHHQKLKNITVYLELHLANNNISKITLEMLP
KKISYLDLSNNNLQTLDDRVVGFLRKFKDSAQIKLSGNPWKCQCNYRSLLSFLRDHDPKE
YTLILNRCNISQSDCPDSCVCCLDESTWPSFIVDCTGEGLVNVPKISRKVGYLDLRNNKI
SELNPTEDILLANRSQASPLKLFMSGNPWSCTCRDVEYLNALKSISSRIADFTEMTCSSG
EKLLSIEQEDICPSGLPYYLALAATLTSLLVITNFLVCFRQPLLIWLYEHDLFLSLAASM
ELDQDKRYDAFLAFTHKDEDLVGEFVEHLEKGRPSFRLCFYLRDWLAGECIPDCITRSVR
DSRRIIILMTANFLKSTWGRLEFRLALHATSQDRCKRLIVVVYPDVESFDDLDSELRSYM
VFNTYLERSQPNFWNKLIYSMPHVKMQ
Download sequence
Identical sequences XP_020813841.1.32911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]