SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020817394.1.32911 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020817394.1.32911
Domain Number 1 Region: 634-747
Classification Level Classification E-value
Superfamily Bromodomain 2.88e-31
Family Bromodomain 0.001
Further Details:      
 
Domain Number 2 Region: 507-620
Classification Level Classification E-value
Superfamily Bromodomain 3.01e-31
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 3 Region: 194-299
Classification Level Classification E-value
Superfamily Bromodomain 8.11e-28
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 4 Region: 29-155
Classification Level Classification E-value
Superfamily Bromodomain 9.29e-25
Family Bromodomain 0.0012
Further Details:      
 
Domain Number 5 Region: 369-447
Classification Level Classification E-value
Superfamily Bromodomain 7.72e-18
Family Bromodomain 0.0027
Further Details:      
 
Domain Number 6 Region: 1303-1374
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000576
Family HMG-box 0.0012
Further Details:      
 
Domain Number 7 Region: 805-867
Classification Level Classification E-value
Superfamily Bromodomain 0.0000000183
Family Bromodomain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020817394.1.32911
Sequence length 1656
Comment LOW QUALITY PROTEIN: protein polybromo-1 [Drosophila serrata]; AA=GCF_002093755.1; RF=representative genome; TAX=7274; STAX=7274; NAME=Drosophila serrata; strain=Fors4; AL=Contig; RT=Major
Sequence
MLSRKRRASSISSRQDEDPLQLDDSTPEQSPVQQATTQSARKKRRLDPTELCQQLYDSIR
NIKKEDGSMLCDTFIRAPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLEL
LIGNAKAFYKPDSCEYQDAVSLWHHIQTQRQRILEANGLAEEEPRARRMSRQVRRMTSST
EPGGDTAAAGDDEYNQYEELFASIMTATDPVNDRAMHRMFQLLPSKKIYPDYYDVIEHPI
DLRLIATKIQMNAYSSLMEMERDLLQMTKNACLFNEPGSQIYKDAKALKRIFTQRRIEME
TGKGKLAKRVKSLSSAAIAALKEEVDSTDDEETSKKGEGPMWALFDHLYNAPGTSEHPGV
TGPPLGNSLWKLPVRRFHPEYFELIKRPISMSQIHTKLKKGDYANISDLTADLYLMLDNA
KKAFPASHRTHKDALKMLRLMNAKLVEESLEETSDMEEDEADDADSEVFAVTSQPERRKP
GRPRVNSNSNASHTPNNSNSPKSNRIAINAAIKKKILSIQKYLVDYSVGNRRPIEMFMEK
PPRKVYPDYYDIIQNPIDMNTIEHNIRTDRYATVEDVVSDYRLMFSNCRQYNEEGSNIYE
DANTLERALNDKLKEFPGLVEVKKPLQKYSKVGRKPKIALISDRLWQFYETVREYQEPKG
KRQLSLIFTKLPSKSEYPDYYDIIKEPIDMERIAQKLKQGAYESLDELAADFLLMLENAC
KYNEPDSQIYKDALVLQQLTLQLKQQLRIERDSLPDVPLAVQELFLTLFTTLYNHQDEEG
RCYSDSLAELPEYDELGEGQKVRGISLDLIKRRLDKGAYKRLDIYQEDIFACLERARKLS
RTDSDIFQDSIELQTYFIRKRDEICKDTLSSPALSFTLERLLADVEVSRQQKAQQEEQDQ
EQDKEKDEFNGAKGESMTINQQVYXPGDYVYVQMPENKIPSIASIERLWTSPTNEKLMQA
SIFVRPHETYHVTTRKFLEKEVFKSSISQTISMDKVLGMCYVMNIKDYIKMRPEKLPEKD
VYVCESRYNIQGRWFKKLKSWPPMREGSSIKFVPREQPLELKRVMSVFKERLEKHKGELE
ELKLQETLVEKEKPNVSCDPPPNAEDSSVYYQQYNTVCSGAIKTGDFVYVATQTGKQSVA
QVQQIWEQNGKSYFKGPWLLPPNETTPGLGKQFFRQELLLSTVEEVSPVVGIVGRCAVLE
YAEFINSRPTEISESDVYICESVYDELKKAIRKLVAGNMRKFQHSPAVTEDEIFYFKTPI
KPAKDVKNEINELGMLEDSMDGDTPSLSSDIAAMSSPAPSVNSTPLTSKIKAAKSAKKCL
TGYILYSSEVRKSICQSNPDATFGDISRMVGTEWKNLPSSAKQSWEDRASRQNEETAAMR
RELDDAQNSASPSPQVSQDGQGLIFECQWDKCDYQFEELGDCTEHCMSDASGHIQRHPQA
GVEMEYVCLWRNCPRIKKSTQAFPNVLRLIKHVREVHLSKCGKHLSAGERSKNFVSRRNK
NATLATTVSIPSNNSQSPRGPNNHDASMHLQHQQQHHQQQQLMQQHPQQQTIVLGPPPEP
LFVTVPPRTTRVIHSEAYIKYIESLQTGSHLNVATCQNNWRRAMTHVTPAQVVAKAPLPE
HWIGPNLRDQENVVQALCHLRNFMLDDVLQIRRSCN
Download sequence
Identical sequences XP_020817394.1.32911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]