SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020827940.1.61212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020827940.1.61212
Domain Number 1 Region: 433-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 38-97
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 209-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.17e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.88e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.74e-23
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 641-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-19
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 9 Region: 493-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.18e-19
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 362-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-18
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 11 Region: 173-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000905
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 126-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000099
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020827940.1.61212
Sequence length 704
Comment zinc finger protein 260-like isoform X1 [Phascolarctos cinereus]; AA=GCF_002099425.1; RF=representative genome; TAX=38626; STAX=38626; NAME=Phascolarctos cinereus; AL=Contig; RT=Major
Sequence
MEDLALLLGERAQTPQCFAFPPDRRTEHGMSSGFLPARLRESVTFKDVAVNFTWEEWRYL
EPAQRALYRDVMLENYKNLVSLGLPVSKLDVISLLERKVQWMPEGEVSRGSCTGKNLSKY
KLKKHFSYHSDLIKFYRIHAGEKLHEHNEYGKPYGRRSNVIGHQKIHIGEKLECNNYGKT
FINRGSLIKKKKIETRKKSFECDECGIDFNWRSNLIRHQRTHTGVKPFECNECGKTFSER
ASVTRHQRTHTGEKPFECNECGKVFSRREQLITHERTHTGVKPFLCNVCGKAFRESQVLK
GHQRTHTGEKPFECNECGKAFSWKGHLIMHKRTHTGEKPFQCNECGRAFCQRGSFNRHQR
THTGEKPFECNECGKAFSLKSVLKIHQKTHIAVKPFECNVCGNAFSDRNVLKSHQKIHSR
VKPFECNACGIGFQWRSSLVIHQRTHTGEKPFVCNECGKCFSRKENLIRHQRIHTGVKPF
ECNECGKSFSESIHVTHHRTRIGERPFECSECGKGFSRKGSLIRHQKIHSGLKPFECNEC
GKTFSERASINRHQRTHTGEKPFECNECGKVFSRREQLIAHERIHTGLKPFLCNICGKAF
SESQGLKRHQRTHTGEKPFECNECGKAFSSSNVLKSHQRIHTGEKPFECNECRRAFSSSN
GLKSHQRTHTGDKPFECNECGRAFSSSNVLKSHQRIHSYKSEII
Download sequence
Identical sequences XP_020827940.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]