SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020831037.1.61212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020831037.1.61212
Domain Number 1 Region: 433-650
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000213
Family GUN4-associated domain 0.09
Further Details:      
 
Domain Number 2 Region: 5-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000397
Family APC10-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020831037.1.61212
Sequence length 936
Comment centrosomal protein of 104 kDa [Phascolarctos cinereus]; AA=GCF_002099425.1; RF=representative genome; TAX=38626; STAX=38626; NAME=Phascolarctos cinereus; AL=Contig; RT=Major
Sequence
MPHKIGFVVVSSSGHEDGFSAKELMVHAPTVNGWRSPRFCQFPQEIVLQMVERCRVRKLQ
LLAHQYMISSKIEFYISDSLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDA
VGQFLKLIFHKNHVNRYNLYSQVALVAVNIIGDPADCSDESNISSREKLIDHYLGQSSDD
SGLEGSYVGKPDYISPLDDLAFDMYQDPEVAHIIRRLDEKKREAVQKERYDHAKKLKQAI
ADLQKVGERLGRYDVEKRCAVEKEDYDLAKEKKQQMEQYRSKVYQQLQLHNLLDSEMIRK
PFDFPLAPLVHSASPCLQKSAQSPLHREEQTGEKPYVDPFPPAKTQLPASLNVPPTQQAA
VGQLSASVSLSKINVDLLPYDERPLPAVLKQQGETNVEPEKVEEDVSMVPKGGIAGEPEP
LTEKALREASSAIEVLGEALVAGAYSKTWSYREDALLSLYNKIMTMPVGTSKEDLKNLLR
AAIFLIRRAIKDLVPSVFQASLKLLKMIITQYIPKHKLGKPETALSVEKTLPNLLTRTGD
SSARLRIVASNFIQELALCKEIKPLQIIPTYLVQPLKQNSSTHLAMSQTDLLARLLKDLG
TESSGFTVDNVMRFSVSALEHRIYEIREIAVKIILDMYKKHRTLILEYLPADDGNARKNI
LYKTLFEGFAKIDGKAVAADSRAQKKAATEQAEKQKKEEIKVLQVQLAALREIQAEAQIE
KDKESDTRKEKNQDDPQRKAVHPNAPDIPDDHPSVANYLDFLCIFCGERDDSFTEEGLDL
HYWKHCPMLTRCEHCKQVVEIASLTEHLLTECDKRDEFGKCHRCCEAVLKEELPKHIKIK
ACNPARSEKLANRCPLCHENFTPGEEAWKSHLTGPAGCTMNLRKAYYLQKTQAMQLGKAV
DSVMAKSGTSGSTFGSKIPTPKGGLNKSSSRAYTKR
Download sequence
Identical sequences XP_020831007.1.61212 XP_020831013.1.61212 XP_020831022.1.61212 XP_020831030.1.61212 XP_020831037.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]