SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020835639.1.61212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020835639.1.61212
Domain Number 1 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.45e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-24
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 146-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-24
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 90-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-22
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 6 Region: 188-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 52-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 500-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000061
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 10 Region: 417-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000469
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 333-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000165
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000327
Family KRAB domain (Kruppel-associated box) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020835639.1.61212
Sequence length 558
Comment LOW QUALITY PROTEIN: zinc finger protein 420-like [Phascolarctos cinereus]; AA=GCF_002099425.1; RF=representative genome; TAX=38626; STAX=38626; NAME=Phascolarctos cinereus; AL=Contig; RT=Major
Sequence
MLENYRNLVSLGFAVSKPDVICQLERKETSWMPEADILRSSCSGSKEFTGEKCYECRECG
KAFKSKKQLTVHQRIHTGAKHYECKECGKAFIYNSEIILHQRIHSGEKPYECSVCGKAFR
MKSKLTLHQRXHTGEKLYECKECGKAFIYGSELSQHQRIHTGDKPYECSVCGKAFRMKSK
LTWHQSIHTEEKPYECNVCGKAFRRKQPLTVHQRIHTGEKPYECSECGKAFTRKTQLTVH
QRIYLGKIHHECKEYGKAFHYNSKLITQQRIYAVEKPYKCSICGKAFGIKSKLTLHQRIH
TGEKPYECKQCGKAFIQNSDLILHQRIHTGEKPYDCSVCGKAFRMKSKLTLHQRIHSGVK
PYECKECGKAFISNSDLILHQRIHTGEKPYECSECKMAFRCKEQLTAHQRNHTGEKPYEC
SECGKAFMNKRILTVHQSIHTGEKPYECSECMKAFNRKESLTLHQSIHTGEKPYECSVCR
KDFRSKQQLTVHQRIHTGEKLFECSECGKAFRSKACLTGHQRIHTGKKPFECSKCGKAFR
SKIQLTFRQITHITEKPH
Download sequence
Identical sequences XP_020835639.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]