SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020836767.1.61212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020836767.1.61212
Domain Number 1 Region: 42-574
Classification Level Classification E-value
Superfamily Sema domain 2.62e-100
Family Sema domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1442-1565,1731-1912
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-35
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 916-997
Classification Level Classification E-value
Superfamily E set domains 0.000000000000098
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number 4 Region: 1007-1096
Classification Level Classification E-value
Superfamily E set domains 0.000000000000216
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 5 Region: 1095-1175
Classification Level Classification E-value
Superfamily E set domains 0.00000000000292
Family E-set domains of sugar-utilizing enzymes 0.056
Further Details:      
 
Domain Number 6 Region: 577-629
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000017
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020836767.1.61212
Sequence length 1955
Comment plexin-D1 [Phascolarctos cinereus]; AA=GCF_002099425.1; RF=representative genome; TAX=38626; STAX=38626; NAME=Phascolarctos cinereus; AL=Contig; RT=Major
Sequence
MVPPAVGGAARSPRLLGVTTPLPQPLLLLLLLLEGSAALEIQRRFPSPTPTNNFALDGPG
GKVYLAAVNRLYQLSGPNLSLEAEEAVGPVRDNPLCHAPQLPQASCEHPKMLTNNYNKIL
QLDPGQGLVVVCGSIYQGFCQLRRLGNISAVAVSFPPTADGTEPVTVFPSMLNVAANHPN
ASTVGLVLEPPSGVLGGASAGGGTRLLVGATYTGFGSQFFPRNQSLEDHRFENTPEIAIR
SLDTRGDLAKLFTFDLNPSDDNILKIKQRAKALHKLGFVRAFLHPGSSGGAAAPHRRNGP
WAPTTPAYAYLALNSEAKAGDKESQSHSLLARICLGWGPAGGPGGAAAETKKLTESYIQL
KLHCGGPAGGEVFNRLVSVFPAAPGPSRPEDLLFGVFERAAPGGTGGAGARAQSALCVFR
FMDIEGAIRAARRACFVDPSPDVVAVLESVVQGTGPACEKKRNIQLQPEQLDCGAAHLQH
PLSILQPLKAVPVFRYLGLTSVAVASVNNYTVVFLGTANGRLLKINLNSAMNIMSRKSIT
VAYGEAVHHIMQFDPSDPSYLYVMTSHQMARVKVAVCDQYTTCPDCLAAEDAYCGWCAME
TRCSLQHECANSSQPHFWTSASEGVQCCPSMTILPSEINIHQEYSGMIIQISGNMPSLSG
MEMACDYGNGIHTVARVPGPDFSHQIAYCNFLPRDKYPEFPSDQDHVTVQTAVQVNGRNI
VWANFTIYDCTRTGRVYPHTACTSCLSTRWPCFWCTQQHTCVSNVSECGSTANPTDSQDC
PRILPMPLAPVPTGGLQNIHVSLANTVFFSQGVSLACNFGSDETFEATWVNASEIQCSQV
VLHTPQRSQIFPVNLQLKGKPDRFIDSPEKMTVEVYNCAMGSTDCSQCMGREDLGHRCIW
NEGCRLNNQPVPVATTCPAPEIRKIEPLSGPLEGGTLLTIRGKNLGRRFSEVAHSTWIGG
VACEPLPSRYIVSEEIVCWTGPSPSPFSDVVSVNVSKEGKSKERYSYVLPVVYSMEPDVG
PKAGGTRVTIRGSDLGVGSELHVLVNDTKQCLNLVRTDSTITCTMPRGELLATVRVCVRF
EHKSCMNSNITFDYMRDPVITAISPRKSPVSGGRTITVEGSRFDMVQNVSMMVNHIGKEQ
TLCKVLNSTLITCPSPGATANKSAPVNFFINGQPYEDEQVAMEDPGEPKNMLPSSRFSLE
YLPDPQFSTAKREKWIKHHPGEPLTLVIHKEQDNLGLECQEYQVKIGQTSCEIQIVSDRV
IHCSVNESLSTSEGHLPITIQVGNFNQTIATLQLGGSETAITVSVVICSILLLLSIVGLF
VFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEY
KHFVTRTFFPKCSSLYEECYILPSQPLNSQGGAQVQETHPLLLGEWKIPESCRPNMEEGI
ALFSTLLSNKHFLIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDL
IDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLRETVGEPFFLLLCAIKQQINKGSI
DAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEA
FCKNVPYSQWPRVEEVDLEWFASSTHSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASL
AMSLTDKKDSTLSRVKDLDTEKYFHLVLPTDELIESKKSHKQSHRKKVLPEIYLTRLLST
KGTLQKFLDDLFKAILSIREDKPPLAIKYFFDFLEEQAEKRGITDPDTLHIWKTNSLPLR
FWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPE
YRKIVQRYYKQIHDMTPLSEQEMNAHLAEESRKYRNEFNTKVAMAEIYKYAKRYRPQIMA
ALEANATTRRTQLQHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_020836767.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]