SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020838152.1.61212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020838152.1.61212
Domain Number 1 Region: 54-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.92e-292
Family Motor proteins 1.88e-16
Further Details:      
 
Domain Number 2 Region: 836-961
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.4e-22
Family Myosin rod fragments 0.00032
Further Details:      
 
Domain Number 3 Region: 955-1072
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.14e-20
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 4 Region: 1241-1349
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.57e-17
Family Myosin rod fragments 0.0032
Further Details:      
 
Domain Number 5 Region: 1059-1150
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000275
Family Myosin rod fragments 0.0039
Further Details:      
 
Domain Number 6 Region: 1349-1450
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000445
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number 7 Region: 1514-1627
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000458
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 8 Region: 1759-1860
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000883
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020838152.1.61212
Sequence length 1960
Comment LOW QUALITY PROTEIN: myosin-9 [Phascolarctos cinereus]; AA=GCF_002099425.1; RF=representative genome; TAX=38626; STAX=38626; NAME=Phascolarctos cinereus; AL=Contig; RT=Major
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSEKNGFEPASLKEEVGDEAIVELIE
NGKKVRVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMSIPEEEQMGLLRVISGVLQLGNIAFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLSKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVKEKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIILEDQNCKLAKEKKLLEDRISEFTTNLTEEEEKSKSLAK
LRNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLNDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNLALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLDDEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQALENERAELSNEVKALLQGKGDSEHKRKKVETQLQELQVK
LTEGERVRTELADKVTKLQVELDNITGLLNQSDSKSSKLAKDFSALESQLQDTQELLQEE
TRQKLSLSTKLKQTEDEKGTLREQLEEEEEAKRSLEKQIATLHAQVADMKKKMDDGVGCL
ESVEEAKRRLQKDLEGVSQRYEEKAAAYDKLEKTKTRLQQELDDLLVDLDHQRQIVSNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAIEQKAELERLNK
QFRAEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQALKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLELDLK
DLEAHIDSANKSRDEAIKQLRKLQAQMKDYMRELDDTRASREEILAQSKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQSNTELVNDRLKKANLQIDQINTDLNMERSHGQKNENARQQLERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRAEKKLKDVILQVDDERRNAEQ
YKDQADKVTVRLKQLKRQLEEXEEEAQRANASRRKLQRELEDVTETADAMNREVSSLKNK
LRRGDLPFVVPRRVARKGPGECSDEEVDGKADASDAKAAE
Download sequence
Identical sequences XP_020838152.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]