SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020838528.1.61212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020838528.1.61212
Domain Number 1 Region: 76-529
Classification Level Classification E-value
Superfamily Sema domain 1.05e-120
Family Sema domain 0.0000791
Further Details:      
 
Domain Number 2 Region: 1384-1513,1690-1876
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-49
Family p120GAP domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 864-958
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000204
Family Other IPT/TIG domains 0.009
Further Details:      
 
Domain Number 4 Region: 532-582
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000384
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 956-1050
Classification Level Classification E-value
Superfamily E set domains 0.000000000891
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.031
Further Details:      
 
Domain Number 6 Region: 1048-1164
Classification Level Classification E-value
Superfamily E set domains 0.0000178
Family E-set domains of sugar-utilizing enzymes 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020838528.1.61212
Sequence length 1909
Comment LOW QUALITY PROTEIN: plexin-B2 [Phascolarctos cinereus]; AA=GCF_002099425.1; RF=representative genome; TAX=38626; STAX=38626; NAME=Phascolarctos cinereus; AL=Contig; RT=Major
Sequence
MRDRLYLKQKRNDSDHGVRHVCLCSRVAEAAEGHRLERILDLEAGRVLRSRMASWVWALT
LWSAMWHVVHSSRPRKLEFFRSKTELNHLVVDDVSGTVYLGAVNALYQLTTDLQLVHMVE
TGPALDNKKCTPPIEQSQCQEAVFTDNVNKLLLLDRPGGRLVECGSLFKGICALRELGNI
SHRIFYEDSSGEKSFVASNDERVSTVGLVTSVGRGDEGGGLAERVLFVGKGNGPHDNGII
ISTRLLDRKDGKEAFEAYTDHTAFKAGYLSANTQQFVAVFEDSDYVFFLFNQQDKQPAKN
RTLVARMCKQDPFYYSYFEMDLECHGNSGEVYSVCHAASVAAPGATPGAGQVLFAVFGKD
SKGSGGNPRSALCLFPLADIHEKMEENRNKCYTGAQGSGSQNFYKPFHGDVQCASHGPMA
SQSFRCGSEHLPYPLGSRDGLVGTAALQRDGLNLTAVTVTTENGHTVVLLGTSDGRILKV
FLTADDGESKEYGSILVELNKRIERDLLLSANGTSLYVMTQDKVFRLPVQDCLSYSTCEQ
CQNSQDPYCGWCVLEGRCTRKVDCLRAEEENHWLWSRGNTCVAVTSAQPQNMSRRAQGEV
YLTVSPLPALTINDDLQCSFGDSLAHPAHVKGDTIICNSPSSIPPTPPGQDHVEVRIVLT
FLRTPVFLTSHMYPFYDCKEAMSLAENVPCISCASNRWNCQWDLRYHECRESSANPEEGI
IKSHMEENCPQFLNPSPLVIPMNHETPVTFEGKNLDPVKVSSLHVGSEKLKFEEPVSTGE
SGTFTFTTPKLSYDGNETLPLNLYIKSYGKNIDSKLEVTLYNCSFGRSDCSLCLASNPAY
SCVWCGGQNQCVYEALCSNITTECPAPVITKIEPETGPLGGGIRVTILGSNLGIRADDVK
RITVAGKNCDFQKAQYSVSTRIVCEVEPSEEAITGGIEVDINGKLGQSPPHVQFTYRQPV
PKEVSPIQGPQAGGTTLVISGSYLDTGSPKDVRVILGNSKKGVPCEVIEFGPDIRCVTGP
YEALGEVPIEVFYGSSLTSGNRITFTYRENPVLKAFEPLRSFVSGGRNINITGQGFDLIQ
NFSMVVIAEPLRSWSKRRKRQAQSPLQATTVVGTTYIRYSDTKVVFSSPQVPDEPEAYNI
TTLLQMDGHRVLLKTEAGAFEYVPDPTFENFTDGVKKQVNKLIHARGTNLNKAMTIHEAE
AFVGAERCFMKTLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGAREWVLGRVEY
DTRMSDMPLSIILPLVIIPMVAIIAFSIYCYWRKSQQAEREYEKIKSQLEGLEESVRDRC
KKEFTDLMIEMEDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPESRR
QTVEQALNQFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIM
RTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDTAGEPLYKLFKAIK
HQVEKGPVDAVQRKAKYTLNDTGLLGDDVEYIPLTVNVIVQEEGVDAIPVKVLNCDTITQ
VKEKIIDQVYRTLPCSRWPKAETVVLEWRPGSTAQILSDLDLTSQRDGRWKRINTLMHYN
VRDGATLILSKMGISQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVEEGKSKRGSVK
EKERTKAITEIYLTRLLSVKGTLQQFVDNFFHSVLTPSPTVPPAVKYFFDFLDEQAEKHE
IKDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVPEVVDSSLSVIAQTFMDACTRTEHK
LSRDSPSNKLLYAKEISTYKKMVEDYYRGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLV
ALHQLYQYTQKYYDEIINALEEDSAAQKMQLAFRLQQIAAALENKVTDL
Download sequence
Identical sequences XP_020838528.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]