SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020854719.1.61212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020854719.1.61212
Domain Number 1 Region: 61-522
Classification Level Classification E-value
Superfamily Sema domain 1.83e-118
Family Sema domain 0.0000995
Further Details:      
 
Domain Number 2 Region: 1694-1821,2009-2195
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-46
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1159-1254
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000966
Family Other IPT/TIG domains 0.0074
Further Details:      
 
Domain Number 4 Region: 1251-1343
Classification Level Classification E-value
Superfamily E set domains 0.000000000000012
Family Other IPT/TIG domains 0.031
Further Details:      
 
Domain Number 5 Region: 525-576
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000706
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 1340-1385,1419-1472
Classification Level Classification E-value
Superfamily E set domains 0.000000000021
Family E-set domains of sugar-utilizing enzymes 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020854719.1.61212
Sequence length 2228
Comment LOW QUALITY PROTEIN: plexin-B1 [Phascolarctos cinereus]; AA=GCF_002099425.1; RF=representative genome; TAX=38626; STAX=38626; NAME=Phascolarctos cinereus; AL=Contig; RT=Major
Sequence
MQLVLWRKKSSPGDLIHTGHAAVCLLCLLYQVTMLILGSALLQLLWAVCAPASVMQQSTL
ISFIPNNTRLQHLVRDPSSGTLYLGATNFLFQLNSELTLEATVSTGPVLDSRDCLPPVLP
LECPQAQPTDNPNQLLLVSPRGPGGDEGALVVCGSAHQGVCEQRRLDHIGQLLLRPERPG
DTQYVAANDPAISTVGLVGQGPAGEPLLFVGRGYTSRGVGGGIPPITTRALRPSDPQAAF
SYEETAKLAVGRLSEYSHHFVAAFARRTSVYFLFLRRDLQAQSRAFRPYLSRVCLSDQHY
YSYVELPLSCGGAPYGLVQAAAVAVPGMGSQGDGREVLFAAFSSVNPSAAGRAPTAGVSG
ASALCAFPLDEVDQLANRTRDACYTRDGRAEDGTEIAYIEYDVNSNCAQLPLDTLDAYPC
GSDHTPSPMASRVPLKAIPLVEWADVQLTAVAVSVEDGHTIAFLGDSQGQLHKVYLGPEG
DHRPYATQLIQSDSAVSSDLIFDWALEHLYVMTQNTVVRVPVASCSQHLNCTSCLAPKDP
YCGWCVLLGRCSRRSECSRGRGPEPWLWSFSPEPKCLRIQSVSPANVSREEKRNIFLSIS
DLPVLRPDESYSCYFEEYESPAVWTDAGVMCPSPDPSRTPALQMGADHVLVPLLLKFGEV
VIASTEFSFYDCAAVAVLHLSTPCQACVQSTWGCSWCVWQHLCTHKTACEAGPIVHSQRL
PLSASWPLLSSVAPTGDVHTFTLSVPPKXPVTPVPKLPPTEPGTLLVESTSPSTDPMPPP
TEQTPRTPPPKPGPPLTVPMPASTAPPTTEAFAFIPSTVGSEVTLGPALETSLTEEPSHL
PSISVDPGIMEGVGDTVTIVDAPGAVTKLEDILPPAPSPSPLGGQPSDTTVLTSSSWDLG
TLALSSSPPWDHAPSTGPSTTFPGVAGSEEHAPDWLLREDELPEADEWTGSDASPFSTST
LLSGDGDSSEFEGPNAPHILLPDLDYQYDSPGLWELEEAVNQGPAACPCVEGIEGSSLLP
VQIEHELTLLGRNFHLYQDGLGDYECVLELEGHMEVTEARVECDGVTGALCRIICQLHQL
SYAAPQPEFHVPMFLRKSGRLRMDSAEGLHVTLYDCSVGRPDCSLCRTADPRYSCVWCDG
DHPQCAAREACAEAEAALCPAPLIHTVEPLTGPVDGGTRITIRGSNLGQKHQDIAETVAV
AGVPCVVDAREYEVSSSIVCVTGASGEEKVGHVTVEVPGGGHGISDHKFAYQDPEVKSIF
PIRGPKAGGTYLTLQGSKLLTGRLEDIRVLVGDHPCQLFSVAQMEQLQCQTSPSPVSAAL
QVAVWFGGVERQLQQGLFQYTPDPNITSAGPAKSFISGGRVIWVHGQNLDVVQTPRIRVT
ISTQEQHLRQRRGLGRRRRIVPETGPECSQDTPCSTRHFEEPCHINSSHLLVCRTPAIPG
ISGGTWVQLEFVLDNLLFDFATLHPTRFSYEANPILRPLNVEDPSSPFRHKPGSVLSVEG
ENLDLAISKDEVVAMIGDGTCLVKTLTRNHLYCEPPAEQPPPRHREGLNSLPEFTVQMGN
LNFTLGRVQYDIESPLAFPVGAQVGLGVGASLLALGVLIIVFIYRRKSKQALRDYKKVQI
QLENLETSVRDRCKKEFTDLMTEMTDLTSDLVGSGIPFLDYKSYAERVFFPGHRQSPLHR
DLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHG
KLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPL
YMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDLEYRPLTLNAVTVPGVGLAESPGV
PVKVLDCDTISQAKEKILDQLYKGVPLAQRPDPGALDVEWRSGVAGHLILSDEDVTSVVQ
GAWRRLNTLQHYKVPDGATVALVPRFSKHIPRENQDYVPGEKTPMLEDMDEGGIRPWHLV
KPSEEPEPPRQRRGSLRGGDRERAKAIPEIYLTRLLSMKGTLQTFVDDLFQVILSTSRPV
PLAIKYFFDLLDDQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDA
VLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTISASDQEM
NSALAELSRNYSGDLSALVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQIAAA
VENKVTDL
Download sequence
Identical sequences XP_020854719.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]