SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020895612.1.97939 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020895612.1.97939
Domain Number 1 Region: 29-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 2 Region: 90-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 2-31
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 4 Region: 133-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family Laminin-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020895612.1.97939
Sequence length 171
Comment laminin subunit beta-4-like, partial [Exaiptasia pallida]; AA=GCF_001417965.1; RF=representative genome; TAX=1720309; STAX=1720309; NAME=Exaiptasia pallida; AL=Scaffold; RT=Major
Sequence
KGYAGKQCDKCADGYYGSPLVPGGSCKPCVCNNNIDPFAKGNCDHVTGECKKCLANTAGF
SCERCAPGYHGSALARNCTKCICDKQGTAPGFEDTCDDETGQCNCLPNVEGSQCZRCVEG
YWDLGSGTGCKQCDCCEEGSQKTMCDQVDGQCHCKAGYGGPRCCECENGYW
Download sequence
Identical sequences XP_020895612.1.97939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]