SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020915700.1.97939 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020915700.1.97939
Domain Number 1 Region: 48-200
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.29e-28
Family Ankyrin repeat 0.00088
Further Details:      
 
Domain Number 2 Region: 255-299
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000484
Family SOCS box-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020915700.1.97939
Sequence length 334
Comment receptor-interacting serine/threonine-protein kinase 4-like [Exaiptasia pallida]; AA=GCF_001417965.1; RF=representative genome; TAX=1720309; STAX=1720309; NAME=Exaiptasia pallida; AL=Scaffold; RT=Major
Sequence
MEKKNVFSRFLSKLKSGTSSNVEELSGRFLSLVRDLPLCGETPWKLREVERLLAQGAPIX
ARTSQDHXTALHXACRNKDLATSELLIRLGINVNAEDLNKSTAMHLAVGNSXVNSALIRL
LHENGANLNAVNRSKETPLXLAAMLEDPSCARTLISLGADLYMCSTPENSIAAWPANRPL
MYAVRSGRLATILLLLQAGGSFEDFCPRRLLSYGYSRCIHFKIIQLFVEAGLKVPKDFFI
TEMESFESWPDSLKEWLCNPLPLQVLCRKKIRKCIGGSNLEKKVSQLCLPXKMKKRLQYD
IESFDLDVKCKTSSQNKTDLFYSFNIYGHKEFYS
Download sequence
Identical sequences XP_020915700.1.97939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]