SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020921311.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020921311.1.46622
Domain Number 1 Region: 556-690
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.96e-59
Family A middle domain of Talin 1 0.00000035
Further Details:      
 
Domain Number 2 Region: 790-925
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.96e-53
Family I/LWEQ domain 0.00000024
Further Details:      
 
Domain Number 3 Region: 2332-2522
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.16e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 695-819
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.24e-48
Family I/LWEQ domain 0.000000481
Further Details:      
 
Domain Number 5 Region: 1878-2010
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.1e-46
Family VBS domain 0.000000463
Further Details:      
 
Domain Number 6 Region: 1262-1398
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1e-37
Family VBS domain 0.015
Further Details:      
 
Domain Number 7 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-34
Family Second domain of FERM 0.000000558
Further Details:      
 
Domain Number 8 Region: 1112-1244
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.14e-27
Family VBS domain 0.027
Further Details:      
 
Domain Number 9 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 10 Region: 1447-1592
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000103
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 488-537
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 0.0000000615
Family A middle domain of Talin 1 0.0002
Further Details:      
 
Domain Number 12 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000117
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 13 Region: 1732-1851
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000314
Family VBS domain 0.023
Further Details:      
 
Domain Number 14 Region: 2047-2169
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000111
Family VBS domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020921311.1.46622
Sequence length 2578
Comment talin-1 isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEALAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTVMVDDSKTVTDMLMTICARIG
ITNHDEYSLVREIMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAVSMGWRPGRRSRSW
DSREQGWVDWSRAHAEAGFSFSQASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAG
DPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGSGRPLLQAAKGLAGAVSELL
RTAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDTDPHFQDVLMQLAKAVASAAAALV
LKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLV
AKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNELLQHVRAHATGAGPAGRYDQATD
TILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKIL
ADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNVAAQNAIKKKLVQRLEHAAKQ
AAASATQTIAAAQHAASTPKTTAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQ
LALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQE
ACGPLEMDSALSVVQNLERDLQEVKAAARDGKLKPLPGETMEKCAQDLGNSTKAVSSAIA
QLLGEVAQGNENYAGIAAREVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKAS
SLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRL
LSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLE
AGVEMASQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPAAPNLKSQLAAAARAVT
DSINQLITMCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENSKVL
GEAMTGISQNAKNGNLPEFGEAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVE
PTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKR
QFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSS
VPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDS
IKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQML
TAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLD
QTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGV
VGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELG
PLANQLTSDYGRLASEAKPAAVAAENEEIGAHIKHRVQELGHGCAALVTKAGALQCSPSD
AYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGT
LNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVK
LGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVT
NVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGIT
MATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAFHPDVAPDVRLRALHYGREC
ANGYLELLDHVLLTLQKPSPELKQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPTV
IAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAA
SAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEK
LISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFEEP
ENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARKKLAQIRQQQYKFLPSELRDEH
Download sequence
Identical sequences XP_020921311.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]