SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020924185.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020924185.1.46622
Domain Number 1 Region: 342-402
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.76e-17
Family Erythroid transcription factor GATA-1 0.00014
Further Details:      
 
Domain Number 2 Region: 287-340
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.5e-16
Family Erythroid transcription factor GATA-1 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020924185.1.46622
Sequence length 480
Comment endothelial transcription factor GATA-2 isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYY
ANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVNP
FSKTPLHPSAAGGPGGPLSVYPGAGGGGGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKE
VSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLAAMGTQP
ATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
TATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLW
RRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKNKKGAECFEELSKC
MQEKASPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Download sequence
Identical sequences Q865U9
9823.ENSSSCP00000012381 NP_999044.1.46622 XP_020924184.1.46622 XP_020924185.1.46622 ENSSSCP00000012381 ENSSSCP00000012381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]