SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020925024.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020925024.1.46622
Domain Number 1 Region: 51-547
Classification Level Classification E-value
Superfamily Sema domain 1.31e-100
Family Sema domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1411-1536,1702-1858
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.02e-34
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 979-1069
Classification Level Classification E-value
Superfamily E set domains 0.000000000000014
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 4 Region: 888-979
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000502
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 5 Region: 1067-1147
Classification Level Classification E-value
Superfamily E set domains 0.000000000373
Family E-set domains of sugar-utilizing enzymes 0.052
Further Details:      
 
Domain Number 6 Region: 550-602
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000432
Family Plexin repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020925024.1.46622
Sequence length 1926
Comment plexin-D1 isoform X2 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MARRAAGGAPLSARAAAASPLPRRPPFPAPSCPLLLLLFLGAARIDALEIQRRFPSPTPT
NNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHPRR
LTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVHFPPAAPPAQPVTVFPSM
LNVAANHPNASTVGLVLPPAAGTGGSRLLVGATYTGYGSAFFPRNSSLEDHRFENTPEIS
IRSLDARGDLAKLFTFDLNPSDDNILKIKQSAKEQHKLGFVRAFLHPPDPQPGAQTYAYL
ALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLV
SVFPARERLFAVFERPQGALAARTAPAALCAFRFADVQAAIRAARNACFVDPAPDVVAVL
DSVVQGTGPACERKLNIQLQPEQLDCGAAHLQHPLSILQPLKASPMFRAPGLSSVAVASV
GNYTVVFLGTVSGRLLKINLNESMQVVSRRVVTVAYGEPVHHIMQFDPADPGYLYLMTSH
QMARVKVAACAMHATCRDCVGAADAYCGWCALETRCTLQQDCANSSQPHFWTSASEGPGH
CPTMTVLPAKIDVHQEYPGMILQISGSLPSLSGMEMACDYGNNIHTVARVPGPAYGHQIA
YCNLLPRDQFPPFLPHQDHVTVEMFLRVNGQNIVRASFTIYDCSRVGQVYPHTACTSCLS
AQWPCFWCIQQHACVSNQSRCEASSNPMNPQDCPQILPAALAPVPTGSSQSVPVHLANAA
FFQGTALECSFGQEEIFEAVWVNESAVRCNQVVLHTTQKSQVFPLSLQLKGQPARFLDSP
DPVTVEVYNCAMGSPDCSQCLGREDLGHQCVWSDGCRLRGTLQPLPGTCPAPEIRAIEPL
SGPLDGGTLLTIRGRNLGRRFSDVAHSVWIGSVACEPLADRYTVSEEIVCATGPAPGAFS
DVVTVNASKEGRSRERFSYVLPLVHALEPTMGPKAGGTRITIQGSDLHVGSELQVLVNGT
EPCTELVRTDTSIACTVPGGALPASVPVCVRFERRGCVHGNLTFWYMRNPVITAIRPRRS
HVSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDF
FLNGRAYADEAAVAEELLDPEEAQRGSRFRLDYLPDPQFSTAKREKWIKHHPGEPLTLVI
HKEQDSLGLESHEYRVKIGQVSCDIQIVSERVIHCSVNESLGTAEGQLPITIQVGNFNQT
IATLQLGGSETAIIVSIVICSILLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIR
EEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLN
SQGSSTVPETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVR
DRCSLASLLTIALHGKLEYYTGIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMS
ICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLN
VSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYV
LRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLP
TDELTEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKY
FFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIA
QAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMNAHLAE
ESRKYQNEFNTNVAMAEIYKYAKRYRTQIVAALEANPTARRTQLQHKFEQVVALMEDNIY
ECYSEA
Download sequence
Identical sequences XP_020925024.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]