SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020937009.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020937009.1.46622
Domain Number 1 Region: 196-208,250-495
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-62
Family Nuclear receptor ligand-binding domain 0.00000000223
Further Details:      
 
Domain Number 2 Region: 144-222
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.6e-26
Family Nuclear receptor 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020937009.1.46622
Sequence length 526
Comment estrogen receptor beta isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MDIKNSPSNLNSPVSYNCSQSVLPLEPGPIYIPSSYVESCHEYSAMTFYSPAVVNYSISS
NSEVGPGRQATSPNVLWPTPGHLSPLAIHCQPSLLYAEPQKSPWCDTRSLEHTLPVNRET
LKRKASGSSCASPVTSPSSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDY
ICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRKQRNSEGHLHCLS
RAKKNGDHTTRVKELLLSTLSPEQLVLTLLEAEPPHVLVSRPSTPFTEASMMMSLTKLAD
KELVHMISWAKKIPGFVELSLYDQVRLLESCWLEVLMVGLMWRSIDHPGKLIFAPDLVLD
RDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPSAAAQEAESSR
KLTHLLNAVTDALVWVIARSGISSQQQSVRLANLLMLLSHVRHASNKGMEHLLNMKCKNV
VPVYDLLLEMLNAHTLRGNKSLVTGSERSRMEESESKEGPQKPQVQ
Download sequence
Identical sequences F1SRR6
ENSSSCP00000005491 ENSSSCP00000005491 XP_020936953.1.46622 XP_020937009.1.46622 XP_020937051.1.46622 9823.ENSSSCP00000005491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]