SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_020940113.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020940113.1.46622
Domain Number 1 Region: 504-723
Classification Level Classification E-value
Superfamily Bet v1-like 6.04e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 91-249
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_020940113.1.46622
Sequence length 732
Comment LOW QUALITY PROTEIN: collagen type IV alpha-3-binding protein [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MQHSGLPVPPSPFSAPPTYLPSVTREDQRLASRGLSSGGGAGRSAGVTATAAAADGWKGR
LPSPLVLLPRSARCQARRLRRRGGRTSSLLQLPPAPERALFLSISPNPSPRGLGASSGTA
RGAGAGLLLHCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVV
LKNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQ
QWIDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMET
FRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGSKEK
VFPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKESEKRRR
VEEEYKNATAELKKKSHFGGPDYEEGPNSFDXXEEFFDAVEAALDRQDKIEEQSQSENGV
RLHGLPPCSGDAFSSVGTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMKVYRR
EVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAIIIY
QTHKRVWPASQRDVLYLSAIRKIPAKTENDPETWIVCNFSVDHNSAPLNNRCVRAKINVA
MICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSY
VQEKTTGKPILF
Download sequence
Identical sequences XP_020940113.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]