SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020954688.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020954688.1.46622
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.18e-29
Family N-terminal domain of MutM-like DNA repair proteins 0.000000441
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.8e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000217
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.35e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_020954688.1.46622
Sequence length 389
Comment endonuclease 8-like 1 isoform X1 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MPEGPELHLASHFVNEACGELVFGGCVEKSPVSRNPEVPFESSAYHISALARGKELRLTL
SPLPGAQPPQEPLALVFRFGMTGSFQLVPRDALPPHAHLRFYTAPPSPQLALCFVDIRRF
GRWELGGEWDPGRGPCVLLEYEQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILHRLRIPPFEKARTVLEALQRHRLSPELTLSQKIKAKLQNPDLLELCHSVPKEVVQLG
GKGYGPESREEDFAAFRAWLRCYGTPGMNSLRDRHGRTIWFQGDPGPLAPKGGKSRKKKS
KGAQQGPEDRVEDPTLQNKATLRTRRTQRGLEQSTAQQPKGTSLQQDPETPLVPEKGKRR
RRQATSGRRRPQKITGDTPSLEPEGTSAS
Download sequence
Identical sequences F1SJ67
9823.ENSSSCP00000002057 XP_001924578.1.46622 XP_005666203.1.46622 XP_013833516.1.46622 XP_013833518.1.46622 XP_020954687.1.46622 XP_020954688.1.46622 XP_020954689.1.46622 XP_020954690.1.46622 ENSSSCP00000002057 ENSSSCP00000002057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]