SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020954865.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020954865.1.46622
Domain Number 1 Region: 264-573
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.64e-116
Family Transglutaminase core 0.0000000166
Further Details:      
 
Domain Number 2 Region: 114-263
Classification Level Classification E-value
Superfamily E set domains 8.75e-45
Family Transglutaminase N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 587-698
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.41e-30
Family Transglutaminase, two C-terminal domains 0.00051
Further Details:      
 
Domain Number 4 Region: 699-798
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.09e-29
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020954865.1.46622
Sequence length 826
Comment protein-glutamine gamma-glutamyltransferase K [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MPSPTPPSGTTDGARSDVGRWGGNPWQPPTTPSPEPEPEPDRRSRRDGRSFWARCCGCCS
CRNTDDDWGPRGDRGAGSRDRGSGSGSRRPDSRGSDSRRPGSRGSGVNAAGDGTIREGML
VVKGVDLLSSRSDQNRREHHTDEFEYDELIIRRGQPFYMVLLLSRPYESSDYVALELLIG
NNPEVGKGTHIIIPVGKGGSGGWKAQVTKSSGQNLNLRVHTSPNAIIGKFQFTVRTRSEA
GEFQLPFNPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNY
GQFDHGVLDACLYILDRRGMPYAGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGT
NPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTS
LTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFNGWQVVDATPQETSSGIF
CCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQNDGSFKIVYVEEKAIGTLIVTK
AIGSHMREDVTHIYKHPEGSEAERKAVETAAAHGSKPNVYATRDSAEDVAVQVEAQDAVM
GQDLTVCVVLTNRGGSRRTVKLHLYLSVTFYTGVTGSVFKESKKEVVLEPGASERVTMPV
AYKEYQPHLVDQGAMLLNVSGHVKENGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQ
IVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASL
DSPQLSQVHGVIQVDVAPAAGGGVFSDARGNSRSGETIPMASRGEA
Download sequence
Identical sequences K7GLF7
XP_020954865.1.46622 ENSSSCP00000028686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]