SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_020955476.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_020955476.1.46622
Domain Number 1 Region: 146-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 202-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 300-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.92e-22
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 94-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.33e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_020955476.1.46622
Sequence length 359
Comment zinc finger protein 391 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MESLQGSSTQRSMNEDAGKSEGQLSRQTKCSTIQKKSSFEKTAIRKVSMTLKEIFTRERG
SESSDFSLSSKLKTQQKIPKEARSPIPRKNSKDKSDLIKHQKTFPQRKPCKHSECGKAFN
YQSDLTVHSGNHGGEKPFECNECGKTFSRSTHLIEHQRTHTGEKPYECSECGKAFSRSTH
LSLHRRIHTGEKPYECRECGKAFSRSTNLSQHQRTHTREKPYKCNECGKAFSDRSTIIQH
QRIHTGENPYECSECGKAFSWISSLIEHQRTHTGENPYECSDCGKVFSRSSSLVEHQRIH
TGERPHECRECGKGFSRSSSLIIHQRTHTGEKPYKCNNCGKSFSQSSTLIRHQQLHTKE
Download sequence
Identical sequences ENSSSCP00000021107 ENSSSCP00000025199 9823.ENSSSCP00000001232 ENSSSCP00000021107 ENSSSCP00000025199 XP_013832955.1.46622 XP_020955476.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]